SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002006 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002006
Domain Number 1 Region: 293-554
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.33e-76
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 172-277
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-32
Family Kringle modules 0.00029
Further Details:      
 
Domain Number 3 Region: 73-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000498
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 111-147
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000577
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002006   Gene: ENSMPUG00000002027   Transcript: ENSMPUT00000002049
Sequence length 558
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896997.1:1039861:1071080:-1 gene:ENSMPUG00000002027 transcript:ENSMPUT00000002049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFASMSLLHILLLMVLAGKTAIGFSLMSLLLDPDPDWTPDYYENSYEEYNQEENSSNAPA
YQENPDWYYMEDDPCLSNPCEHGGDCLVSGDTFTCSCPAPFSGNRCQNVQNKCKNNPCER
GECLITQSPPYYRCACKHPYRGPDCSTAAPACRPNPCQNGGTCSRHRRRTKFTCTCHDQF
KGRFCEIGPDDCYVGDGYSYRGKVSKTVNQHSCLYWNSHLLLQENYNIFMEDAETHGIGE
HNFCRNPDGDKKPWCFIKVNSAKVKWEYCDISVCSALDVADPEGSPTEPLTKLPGFDSCG
RTEMTEKKIKRIYGGFKSTAGKHPWQASLQTSLPLVTSMPQGHFCGGALIHPCWVLTAAH
CTDIKTKHLKVVLGDQDLKKTEFHEQRFGVEKIFKYTHYNEREEIPHNDIALLKLKPVDG
HCALESKYVKTVCLPDNIFPSGTECHISGWGVTETGEGSRHLLDAKVKLIANTLCNSHRL
YDHMIDDSMICAGNLQKPGKDSCQGDSGGPLTCEKNGTYYVYGIVSWGLECGKKPGVYTQ
VTKFLSWIRATIQKEGSF
Download sequence
Identical sequences M3XSF6
ENSMPUP00000002006 XP_004763889.1.14098 ENSMPUP00000002006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]