SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002029 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002029
Domain Number 1 Region: 13-368
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 3.26e-90
Family Extradiol dioxygenases 0.0000000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002029   Gene: ENSMPUG00000002050   Transcript: ENSMPUT00000002072
Sequence length 393
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896936.1:3837043:3849174:1 gene:ENSMPUG00000002050 transcript:ENSMPUT00000002072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTYSDKGKKPERGRFLHFHSVTFWVGNAKQAASFYCNKMGFEPLAYKGLETGSREVVSH
VIKQGKIVFVFSSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDYLVQKAREQGAKIVRE
PWIEQDKFGKVKLAVLQTYGDTTHTLVEKMNYTGRFLPGFEAPISVDPLLSKLPTCSLEI
IDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPI
NEPAPGKKKSQIQEYVDYNGGAGVQHIALKTQDIITAIRHLKARGMEFLGVPSSYYKQLR
EKLKTAKIQVKENIDVLEELKILVDYDEKGYLLQIFTKPMQDRPTLFLEVIQRHNHQGFG
AGNFNALFKAFEEEQDLRGNLTNLETNSSLRGM
Download sequence
Identical sequences M3XSH9
ENSMPUP00000002029 ENSMPUP00000002029 XP_004753247.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]