SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002030 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002030
Domain Number 1 Region: 200-317
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 1.06e-23
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000233
Further Details:      
 
Domain Number 2 Region: 98-206
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 1.61e-21
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000104
Further Details:      
 
Domain Number 3 Region: 45-96
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000204
Family TS-N domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002030   Gene: ENSMPUG00000002051   Transcript: ENSMPUT00000002073
Sequence length 324
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897076.1:2032463:2047132:1 gene:ENSMPUG00000002051 transcript:ENSMPUT00000002073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRSLSLHLVARAGSCSAGPLRLQSLQPWHTFHTGPWLSSAASSKELLMKLRRKTGYSF
VNCKKALETCGGDLKQAESWLHKQAQKEGWSRAAKLHGRKTKEGLIGLLQEGNTTVLVEV
NCETDFVSRNLKFQQLVQQVALGTLLHCQNLKDQLSTYSKGFLNSSELSELPAGPEREGC
LKDQLALAIGKLGENMTLKRAAWVKVPAGFYVGSYVHGAIHSPSLHNLVLGKYGALVICE
TSERRAGLEDLGRRLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYVQ
PQGVSVVDFVRFECGEGEEAAEAE
Download sequence
Identical sequences M3XSI0
ENSMPUP00000002030 XP_004773333.1.14098 ENSMPUP00000002030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]