SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002622 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002622
Domain Number 1 Region: 30-486
Classification Level Classification E-value
Superfamily ALDH-like 4.97e-92
Family ALDH-like 0.00000332
Further Details:      
 
Domain Number 2 Region: 496-769
Classification Level Classification E-value
Superfamily ALDH-like 1.44e-41
Family ALDH-like 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002622   Gene: ENSMPUG00000002650   Transcript: ENSMPUT00000002676
Sequence length 802
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897027.1:1452561:1466148:-1 gene:ENSMPUG00000002650 transcript:ENSMPUT00000002676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATRARPSAREIFATLEYGPAPESHACALAWLDTQDRHLGHYVNGKWLKPEHRNSVPCQ
DPITGESLASCLQAQAEDVVAAVEAAGTAFDTWSGLPGASRAQHLVRLAKMIQKHQRLLW
TLESLVSGRAIREVRDGDVPLAQQLLQYHAIQASTQEEVLAGWEPMGVIGLILPPTFSFL
EMMWRICPALAVGCTVVVLVPPASPTPLLLAQLAGELDSFPGILNVVSGPASLGPVLASQ
PRVQKVTFCGTVEEGRALRRSLAGRGAELGLALGAESLLVLTEAADVDSAVEGVVDAAWS
DRNAGGLRLLIQESVWDETMRRLQERMARLRGGRGLDGAVDMGARGVAAHDLAQRYVHEA
QSQGAQVFQAGDVPSDSPFFPPTLVSDLPPASPCTQAEVPWPVVVASPFRTAKEALAVAN
GTPRGASASVWSERLGQALELGWGLQMGTVWINAHGLRNTQVPAGGCKESGSSWHGGPDG
LYEYLRPSGTPARLSYFSENLNYDTFGLSVPSTLPAGTETGPSPAAPYGLFIGGRFQAPG
SRSSRPIQDLQGNLHSYVAEGGAKDVRGAVEAAHQAAPGWVGQSPGTQATLLWALAAALE
RRESALTSRLERHGVTLKDAQAEVKLSARQLRAWGARAQAQGHVLQVAELKGPVLRLREP
LGVLAIVCPDEWPLLAFVSLLAAALAHGNTVVLVPSGACPIPALEVCQDMAALLPAGLVN
VVTGDRDHLTRCLALHQDVQALWYFGSAKGSQFVEWASAGNLKPVWVNRGCPRAWDQEAQ
GAGQELGLRAARTKALWLPMGD
Download sequence
Identical sequences M3XU72
XP_012919406.1.14098 ENSMPUP00000002622 ENSMPUP00000002622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]