SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002628 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002628
Domain Number 1 Region: 3-55
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000161
Family LEM domain 0.0029
Further Details:      
 
Domain Number 2 Region: 277-322,350-406
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000149
Family Ankyrin repeat 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002628
Domain Number - Region: 158-193
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.0105
Family N-terminal domain of RNase HI 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002628   Gene: ENSMPUG00000002656   Transcript: ENSMPUT00000002682
Sequence length 900
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897208.1:965018:988142:-1 gene:ENSMPUG00000002656 transcript:ENSMPUT00000002682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMDAILARLKLLNPDDLREEIVKAGLKCGPITSTTRFIFEKKLAQALLERGRTLPSHPP
GCDTSSATALSQDAQKMSKSAVESQAEQVGLSEDRDFGYSVGLNPPEEDVVTSKTCSVPF
SAATGVSGHKAVTTASAEPPLYYGVCPAYEDTPARNERIHVYEDRKEALQAVKMIKGSRF
KAFSSREDAEKFARGICDYFPSPSKASSPLSPVKMTSVFSSGGVKDAVYSSESETINRER
ANSYKTPRTQDLTSRLRKAVEMGEADLFSDLTWSNPRYLIGSGDNPTIVQEGCRYNVLHV
AAKENQASICQLTLETLENPEFMRLMYPDDEPHMLQQRICYIVDLYLNTPDKAGYDTPLH
FACKFGNADVVNVLSSHPLIVKNPRNKFDKTPEDVICERSRNKSVELKERIREYLQGHYY
VPLLRAEDTSSPVIGELWSSDQTTETSHIGHGGGGPRDPVLTLRAFAGPLSPSKAEDFRK
LWKTPPREKAGFFHNVRKTDPERGMERVGRELARELGYPWVEYWDFLGCFVDLSSQEGLQ
KLEEYLRHQEAGKKAPQDSGAEEACRQENPSTFGRAGKCSNSISVRAFLDDDDDLSLEEI
KNRQNTARNNTQPTVSTFGDSKCDILPLEQETNLIEASTLTSPHGSKNGFCGPLSGSRTP
GRKRPEAPGAGEALISPVSGLSVEFDKLQLQDLGSNFPKTPNKNGKTRDRKSFTSRTDAT
NDLLEPPAADALTENQTRTESEMSAKMAKIRLGPDTPVPEVQQNCGSMSSEPSGVPTTKE
PVERLFLFGEEPSKLDRDVLAALECTEVDPQRYPAVHRWRSAVLRYSPADRQSWPSPALK
GKLESQQLDVGGPHSCSPGRSPGKPGPASHSPGLGSPGRYSPAHGSHLRRMAHLAQLTAL
Download sequence
Identical sequences M3XU78
XP_004779631.1.14098 ENSMPUP00000002628 ENSMPUP00000002628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]