SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002664 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002664
Domain Number 1 Region: 50-301
Classification Level Classification E-value
Superfamily Carbonic anhydrase 7.72e-65
Family Carbonic anhydrase 0.00000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002664   Gene: ENSMPUG00000002692   Transcript: ENSMPUT00000002719
Sequence length 322
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896965.1:5417269:5469822:1 gene:ENSMPUG00000002692 transcript:ENSMPUT00000002719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVMSSLRVILQASPCKSLWRRFQTPRFVPARPCSLYTCTYKSRNRALHPLWETVDLVPG
GERQSPINIRWRDSVYDPGLKPLTISYDPTTCLHVWNNGYSFLVEFEDSTDKSVIEGGPL
EHNYRLKQFHFHWGAIDAWGSEHTVDSKCYPAELHLVHWNAVRFENFEDAAQEEHGLAVI
GVFLKLGKHHKELQKLVDTLPSIKHKEYILKKGFLKPNGIIVYLPFCSSFFFFAGGIPLP
VKKVTPCTAFPTMPSEVPRIKDELEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSS
FRHDYVLNIQAKPQPSTSQVIP
Download sequence
Identical sequences M3XUB4
ENSMPUP00000002664 ENSMPUP00000002664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]