SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002771 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002771
Domain Number 1 Region: 432-919
Classification Level Classification E-value
Superfamily ALDH-like 6.28e-164
Family ALDH-like 0.000000000747
Further Details:      
 
Domain Number 2 Region: 19-219
Classification Level Classification E-value
Superfamily Formyltransferase 3.14e-50
Family Formyltransferase 0.00000000299
Further Details:      
 
Domain Number 3 Region: 223-325
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 3.3e-26
Family Post formyltransferase domain 0.0000015
Further Details:      
 
Domain Number 4 Region: 342-420
Classification Level Classification E-value
Superfamily ACP-like 0.00000892
Family Acyl-carrier protein (ACP) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002771   Gene: ENSMPUG00000002800   Transcript: ENSMPUT00000002830
Sequence length 920
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897294.1:320817:418182:-1 gene:ENSMPUG00000002800 transcript:ENSMPUT00000002830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIRQSHFPKTHVYFYKSMKIAVIGQSLFGQEVYCHLRKEGHDVVGVFTVPDKDGKADPL
GLEAEKDGVPVFKLSRWRVKGQTLPDVVAKYQALGAELNVLPFCSQFIPMEVINAPHHGS
IIYHPSLLPRHRGASAINWTLIHGDKKGGFTIFWADDGLDTGDLLLQKECEILPDDTVST
LYNRFLFPEGIKGMVQAVRLIAEGKAPRLPQPEEGATYEGIQKKETAKINWEQPAEAIHN
WIRGNDKVPGAWTEACGQKLTFFNSTLNTTGLVPEGENLPIPGAHRPGIVTKAGLLLFGN
DDRMLLVKNIQLEDGKMIPASHFFNGADSSALELTEEELVIAEAVRSAWKRILPNVLEVE
DSTDFFKSGAASVDVVRLVEEVKELCDGLELENEDIYMATTFGDFIQLLVRKLRGDDKDN
KCIIDYVEKAVNKLTLRMPHQLFIGGMFVGAEGAKTYETINPTDGSVICQVSLAQVSDVD
KAVAAAKDAFENGLWGKINARDRGQLLYRLADLMEQHQEELATIEALDAGAVYTLALKTH
VGMSIQTFRYFAGWCDKIQGSTIPINHARPNRNLTLTRKEPIGVCGIIIPWNYPLMMLSW
KTAACLAAGNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNILPGSGSLIGQRLSDHPD
VRKIGFTGSTEVGKHIMKSCALSNVKKVSLELGGKSPLIIFADCDLSKAVQMGMSSVFFN
KGENCIAAGRLFVEDSIHDQFVRKVVEEVKKMKIGNPLDRDTNHGPQNHQAHLQKLVEYC
QHGVEEGATLVCGGKQVSRPGFFFEPTIFTDVEDHMFIAKEESFGPIMVISRFADGDVDT
VLSRANATEFGLASGIFTKDINKALYVSDKLEAGTVFVNTYNKTDVAAPFGGFKQSGFGK
DLGEAALNEYLRVKTVTFEY
Download sequence
Identical sequences M3XUM1
ENSMPUP00000002771 ENSMPUP00000002771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]