SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002922 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002922
Domain Number 1 Region: 158-678
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.77e-49
Family Quinoprotein alcohol dehydrogenase-like 0.015
Further Details:      
 
Domain Number 2 Region: 632-784
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000033
Family Quinoprotein alcohol dehydrogenase-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002922   Gene: ENSMPUG00000002951   Transcript: ENSMPUT00000002981
Sequence length 785
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896944.1:4065580:4210147:-1 gene:ENSMPUG00000002951 transcript:ENSMPUT00000002981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVTDRIASLEQRVQMQEDDIQLLKSALADVVRRLNITEEQQAVLNRKGPTKARPLVQTL
PLRTTVNNGTVLPKKPSGSLPSPSGTRKETAVPASTKSTIKRTSSSERVSPGGRKESHGD
SKGNRNRTGSTSSSSSSKKNSESKPKEPVFSAEEGYVKMFLRGRPVTMYMPKDQVDSYNL
EAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYTGH
NDDVKCLAVHPDRITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGVGFFDRAVTC
IAFSKSNGGSSLCTVDDSNDHVLSVWDWQKTERLADAKCSNEAVFAADFHPTDTNIIVTC
GKSHLYFWTLEGNSLIKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNR
ISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRKLISWNGNYQKLRKTEIPEQFGPIRTVT
EGKGDVILIGTTRNFVLQGTLSGDFTPITQGHTDELWGLAIHASKPQFLTCGHDRHATLW
DAVGHRPVWDKVIEDPAQSSGFHPSGSVLAVGTLTGRWFVFDTETKDLVTVHTDGNEQLS
VMRYSPDGTFLAIGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSN
SGDYEILYWVPSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHE
RKLLSTGDDFGKVHLFSYPCSQFRAPSHVYSGHSSHVTNVDFLCGDSHLISTGGKDTSIM
QWRVI
Download sequence
Identical sequences M3XV22
ENSMPUP00000002922 ENSMPUP00000002922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]