SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002935 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002935
Domain Number 1 Region: 54-523
Classification Level Classification E-value
Superfamily Sema domain 1.57e-128
Family Sema domain 0.0000219
Further Details:      
 
Domain Number 2 Region: 1365-1494,1690-1878
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.22e-51
Family p120GAP domain-like 0.035
Further Details:      
 
Domain Number 3 Region: 966-1055
Classification Level Classification E-value
Superfamily E set domains 1.98e-18
Family Other IPT/TIG domains 0.086
Further Details:      
 
Domain Number 4 Region: 1054-1157
Classification Level Classification E-value
Superfamily E set domains 4.2e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.052
Further Details:      
 
Domain Number 5 Region: 870-967
Classification Level Classification E-value
Superfamily E set domains 0.00000000000187
Family Other IPT/TIG domains 0.015
Further Details:      
 
Domain Number 6 Region: 526-576
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000353
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 7 Region: 1154-1235
Classification Level Classification E-value
Superfamily E set domains 0.0000000784
Family E-set domains of sugar-utilizing enzymes 0.044
Further Details:      
 
Domain Number 8 Region: 822-856
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000183
Family Plexin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002935   Gene: ENSMPUG00000002963   Transcript: ENSMPUT00000002994
Sequence length 1909
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897108.1:340613:548019:-1 gene:ENSMPUG00000002963 transcript:ENSMPUT00000002994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTERLRVLLPAPLRMEQRRPWPRAAEVDSWSVVLLSVVWVLLAPGAAGMPQFSTFHSEN
RDWTFNHLTVHRGTGAVYVGAINRVYKLTGNLTIQVAHKTGPEEDNKSCYPPLIVQPCSE
VLTLTNNVNKLLIIDYSENRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNKT
GTMYGVIVRSDGEDGKLFIGTAVDGKQDYFPTLSSRKLPRDPESSAMLDYELHSDFVSSL
IKIPSDTLALVSHFDIFYIYGFASGGFVYFLTVQPETPEGVAINSAGDLFYTSRIVRLCQ
DDPKFHSYVSLPFGCTRAGVEYRLLQAAYLAKPGDSLAQAFNISSHDDVLFAVFSKGQKQ
YHHPPDDSALCAFPIRAINLQIKERLQSCYQGEGNLELNWLLGKDVQCTKAPVPIDDNFC
GLDINQPLGGSTPVEGLTLYTTSRDRMTSVASYVYNGYSVVFVGTKSGKLKKIRADGPPH
GGVQYEMVSVLKDGSPILRDMAFSVDERYLYIMSERQITRVPVESCEQYTTCGECLSSGD
PHCGWCSLHNMCSRRDKCQRAWEPNRFAASISQCMSLEVQPSSISVSEHSRRLSLVVSDA
PDLSVGISCAFGNLTEVEGQVSGSQVICISPGPKDVPGIPLDQDWFGLELQLRSKETGKI
FVSTEFKFYNCSAHQLCLSCVNSAFRCHWCKYRNLCTHDPTTCSFQEGRINISEDCPQLV
PTEEILIPVGEVKPITLKARNLPQPQSGQRGYECVLNIQGAVHRVPALRFNSSSVQCQNS
SYQYDGMDISNLPVDFAVVWNGNFIIDNPQDLKVHLYKCAAQRESCGLCLKADRKFECGW
CSGERRCTLQQHCTSPSSPWLDWSSHNVKCSNPQITEILTVSGPPEGGTRVTIHGVNLGL
DFSEIAHHVQVAGVPCTPLPGDYIIAEQIVCEMGHALVGTTSGPVRLCIGECKPEFMTKS
HQQYTFVNPSVLSLNPIRGPESGGTMVTITGHYLGAGSSVAVYLGNQTCEFYGRSMNEIV
CVSPPSSNGLGPVPVSVSVDRAHVDNNLQFEYIDDPRVQRIEPEWSIASGHTPLTITGFN
LDVIQEPRVRVKFNGKESVNVCKVVNTTTLTCLAPSLTTDYRPGLDAVERPDEFGFVFNN
VQSLLIYNDTKFIYYPNPTFELLSPTGVLDQKPGSPIILKGKNLCPPASGGAKLNYTVLI
GETPCAVTVSETQLLCEPPNLTGQHKVMVHVGGMVFSPGSVSVISDSLLTLPAIVSIAAG
GSLLLIIVIIVLIAYKRKSRENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINELTS
DLDRSGIPYLDYRTYAMRVLFPGIEDHPVLRELEVQGNGQQHVEKALKLFAQLINNKVFL
LTFIRTLELQRSFSMRDRGNVASLIMTGLQGRLEYATDVLKQLLSDLIEKNLENKNHPKL
LLRRTESVAEKMLTNWFAFLLHKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSL
SEDKLIRQQIEYKTLILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNVPYSQR
PRAVDMDLEWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQTSSY
NIPASASISRTSISRYDSSFRYTGSPDSLRSRAPMITPDLESGVKVWHLVKNHDHGDQKE
GDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQAD
RHGIHDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTS
EHRLGKDSPSNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFN
MLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLISAMSIDS
Download sequence
Identical sequences M3XV35
ENSMPUP00000002935 XP_004775334.1.14098 ENSMPUP00000002935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]