SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002987 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002987
Domain Number 1 Region: 249-425,460-626
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.13e-82
Family YicI catalytic domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 1117-1311,1356-1517
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.12e-71
Family YicI catalytic domain-like 0.00039
Further Details:      
 
Domain Number 3 Region: 4-248
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.35e-48
Family YicI N-terminal domain-like 0.01
Further Details:      
 
Domain Number 4 Region: 870-1114
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 9.1e-47
Family YicI N-terminal domain-like 0.0058
Further Details:      
 
Domain Number 5 Region: 1520-1600
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 7.91e-20
Family Putative glucosidase YicI, domain 3 0.01
Further Details:      
 
Domain Number 6 Region: 629-709
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.08e-16
Family Putative glucosidase YicI, domain 3 0.019
Further Details:      
 
Domain Number 7 Region: 840-892
Classification Level Classification E-value
Superfamily Trefoil 0.00000000419
Family Trefoil 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002987   Gene: ENSMPUG00000003017   Transcript: ENSMPUT00000003048
Sequence length 1741
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896904.1:157282:215071:-1 gene:ENSMPUG00000003017 transcript:ENSMPUT00000003048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QATCDQRGCCWRPQGTISVPWCYYSRSHGYQMEGDLVTTNAGFTAQLKRLPSLSLFGNDV
NNVLLTAEYQTSNRFHFKLTDQSKDRYEVPHEHVQPFKGSAASPLTYEVTVSQQPFSIKV
IRRSNNRVLLDSGIGPLIFADQFLQLSMRLPSANVYGLGEQVHQQYRHDMNWKTWAMFAR
DTTPNGDGTNLYGTQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPTPAVTYRTIGGILDF
YVFLGNTPEQVVQEYLELIGRPVLPSYWALGFHLSRYDYGTLESLKEVMERNRAAGLPYD
VQHADIDYMDARKDFTYDPVNFKGFPEFVEELHSNSQKLVIIVDPAISNSSSPSNPYGPY
DRGSSMKIWVNASDGVTPLIGEVWPGKTVFPDYTNPNCAVWWAKEFELFHNQVEFDGIWI
DMNEISNFVDGSVSGCSTNNLNYPPFTPRILDGYLFCKTLCMDAEQHWGKQYDVHNLYGY
SMAIATAEAVKTVFPNKRSFIITRSTFAGSGKFAAHWLGDNAATWNDLRWSIPGMLEFNL
FGIPMVGADICGFALDAPEELCRRWMQLGAFYPFSRNHNGQGYKAQDPASFGADSLLLNS
SRHYLTIRYTLLPYLYTLFYRAHSRGDTVARPLLHEFYGDSSTWDVHQQFLWGPGLLITP
VLDEGAEKVTAYMPDAVWYDYETGARVRWRKQSVEMELPGDRIGLHLRGGHIFPTQQPAT
TTVASRRNPLGLIIALDDNKEAKGELFWDDGETKDTVANQVYLFCEFSATQNHLDVKILQ
STYKDPNNLVFKEIKILGTQEPINVTVKHNGVPSQISPNVTYDSNLQVALIRGIDLILGE
AYTVEWALKIKEAEKIDCFPDENGASAENCTARGCAWEVPTSPGAPFCYFVSDLYSVGDV
QYHSHGATATLSLKSSLYASALPSVPVTDLRLHVTYHKNDMLQFKIYDPNNNRYEVPVPL
NIPTVPSSTSESQLYNVLIKKNPFGIEIRRKNTGTVIWDSQLLGFTFNDMFIRISTRLPS
EYIYGFGETEHTAFRRDLNWHTWGMFSRDQPPGYKKNSYGVHPYYMALEEDGSAHGVLLL
NSNAMDVTFQPLPALTYRTIGGILDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQL
CRYGYQNDSEIASLYDEMVAAQIPYDVQYSDIDYMERQLDFTLSPKFLGFPALINRMKDD
GMRVILILDPAISGNETQNYPAFTRGVEDDVFIKAPDGGGIVWGKVWPDFPDVVINGSLD
WETQVELYRAYVAFPDFFRNSTTTWWKRELQELCLYIMTFNQNWQDDMNEPASFVNGAVP
PGCKDATLNHPPYMPYLESRDRGLSSKTLCMESEQILPDGSRVRHYDVHSLYGWAQTRPT
YEAVQEVTGQRGIVITRSTFPTSGRWGGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTG
ADICGFFQDAEYEMCARWMQLGAFYPFSRNHNTIGTRRQDPVSWDAAFMNISRSVLLTRY
TLLPYLYTLMHMAHTEGSTVVRPLLHEFVSDRVTWDVDSQFLLGPAFLVSPVLEPNARNV
TAYFPRARWYDYYTGRDIGARGEWKSLEAPLDHINLHVRGGYILPWQEPAQNTHLSRQKF
IGFKVALDDEGTAKGWLFWDDGESIDTYGKGLYYLANFSASQNMMQSHIIFNKYITDSNP
LKLGYVEIWGVGRVPISSVSISTSSMVIMPAFNYDPVTQVLSIDVTTRDISLHNFISLTW
S
Download sequence
Identical sequences M3XV87
ENSMPUP00000002987 ENSMPUP00000002987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]