SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003010 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003010
Domain Number 1 Region: 216-296
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000929
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0069
Further Details:      
 
Domain Number 2 Region: 81-151
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000655
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.06
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000003010
Domain Number - Region: 10-49
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0048
Family HLH, helix-loop-helix DNA-binding domain 0.0094
Further Details:      
 
Domain Number - Region: 440-551
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00824
Family Apolipoprotein A-I 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003010   Gene: ENSMPUG00000003040   Transcript: ENSMPUT00000003071
Sequence length 800
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896969.1:4086900:4103956:1 gene:ENSMPUG00000003040 transcript:ENSMPUT00000003071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSLACIYTRKGVFFAGGT
PLAGPTGLLSSQELEDIVAALPGFLLVFTAEGKLLYLSESVSEHLGHSMVDLVAQGDSIY
DIIDPADHLTVRQQLTLPSALDTDRLFRCRFNTSKSLRRQSAGNKLVLIRGRFHAHPPGA
YWAGNPVFTAFCAPLEPRPRPGPGPGPASLFLAMFQSRHAKDLALLDISESVLIYLGFER
SELLCKSWYGLLHPEDLAHASAQHYRLLAESGDIQAEMVVRLQAKPGGWAWIYCLLYSEG
PEGPITANNYPISDTEAWSLRQQLNSENTQAAYVLGTPTMLPSFPENILSQEQCSSPNPL
FTPALGVPRSTNFPSAPELGAASTSEELPQSQKELGFSYLAFPSGSQPSLQADLSKDLVC
TPPYTPHQPGGCAFLFSLHEPFQTHLSTPSSSLQEQLTPSTATFSDQLTPSSATFPDPLT
SPLQGQLTETSARSYEDQLTPCTSAFPDQLLPSTATFPESLGSPAHEQLTPPSTAFQAHL
NSPSQTFPEQLSPNPTKTYFTQEGCSFLYEKLPPSPSSPGNGDCTLLALAQLRGPLSVDV
PLVPEGLLTPEASPVKQSFFHYSEKEQNEIDRLIQQISQLAQGMDRPFSAEAGTGGLEPL
GGLEPLDSNLSLPGAGPPVLSLDLKPWKCQELDFLADPDNIFLEETPVEDIFMDLSTPDP
NGEWSSGDPEAAVPGGASPPCNNLSPEDHSFLEDLATYETAFETGVSAFPYDGFTDELHQ
LQSQVQDSFHEDGSGGEPTF
Download sequence
Identical sequences M3XVB0
ENSMPUP00000003010 ENSMPUP00000003010 XP_004759482.1.14098 XP_012915518.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]