SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003017 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003017
Domain Number 1 Region: 18-83
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.75e-24
Family Ribosomal L11/L12e N-terminal domain 0.00038
Further Details:      
 
Domain Number 2 Region: 80-155
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 4.58e-18
Family Ribosomal protein L11, C-terminal domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003017   Gene: ENSMPUG00000003047   Transcript: ENSMPUT00000003078
Sequence length 192
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896969.1:4114019:4117982:-1 gene:ENSMPUG00000003047 transcript:ENSMPUT00000003078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKLSRATRALRKPEAGGVIRTIVRAGQAMPGPPLGPILGQRGVSINQFCKEFNEKTKDI
KEGIPLPTKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEI
AQVKAQDEAFALQDVPLSSVVRSIIGSARSLGIHVVKDLSPEELAAFQKERAEFLAAQKE
ADLAAQAEAAKK
Download sequence
Identical sequences M3XVB7
XP_004759483.1.14098 ENSMPUP00000003017 ENSMPUP00000003017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]