SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003083 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003083
Domain Number 1 Region: 298-621
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 4.51e-64
Family Glutamine synthetase catalytic domain 0.00082
Further Details:      
 
Domain Number 2 Region: 188-294
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 1.07e-19
Family Glutamine synthetase, N-terminal domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003083   Gene: ENSMPUG00000003114   Transcript: ENSMPUT00000003146
Sequence length 624
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897116.1:507872:536082:-1 gene:ENSMPUG00000003114 transcript:ENSMPUT00000003146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFVCRDSGINEHLSFDSSSAFPAYCALGVTHQSPVFIFYYVPDPSGKSLHGIHHPQCLV
QDTRDESNETEASRMSKLRRTRKKVTKHVFSTEVGEMDISNSKERIRNQMVCHKLEDVSK
PVVGAGSADSYRPQDDKDSENQTTGIKPSPLKIAASAPGREFNTNSNHTDNTRDGTQIPT
TPHLSSRMKHIKQEMAKNHLQFVRFEATDLHGVSRSKSIPAHFFQEKVIHGVCMPRGYLE
LIPNPKDDEVDHIRATCFNSDIVLMPELSTFRVLPWAERTARVICDTFTVTGEPLLTSPR
YIAKRQLSQLQDAGFSLLSAFIYDFCIFAVPEIINSKTISFPASTLLNNHDQPFIQELVD
GLYHTGANVESFSSSTRPGQMEICFLPEFGISAADNAFTLRTGVKEVARKYNYIASFFIE
TGFCNSGILSHSLWDVGGKKNMFCSNSGVEELTITGKKWLAGLLKHSAALSCLMAPAVSC
RKRYSKESKDLKESVPTTWGYNDNSCAFNIKCHGEKGSRIENKLGSATANPYLVLAATVA
AGLDGLQSSDGVLAGPNDSTDFCQAKSAEIPLKLEDALVALEEDQCLRQALGETFIRYFV
AMKKYELENEETDAERNKFLEYFI
Download sequence
Identical sequences M3XVI3
ENSMPUP00000003083 XP_004775703.1.14098 ENSMPUP00000003083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]