SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003123 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003123
Domain Number 1 Region: 26-144
Classification Level Classification E-value
Superfamily FKBP-like 5.89e-34
Family FKBP immunophilin/proline isomerase 0.00022
Further Details:      
 
Domain Number 2 Region: 147-213
Classification Level Classification E-value
Superfamily EF-hand 0.000000000088
Family Calbindin D9K 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003123   Gene: ENSMPUG00000003155   Transcript: ENSMPUT00000003187
Sequence length 218
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897039.1:5146699:5160047:1 gene:ENSMPUG00000003155 transcript:ENSMPUT00000003187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFLLRLIVFFYVWGIFTAQGQKEEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGFL
AKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMMDMCPGEKRKVIIPPSYAYGKEGY
AEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDTDNDRQLSKTEINHYLQREFEKDDKP
RDKSYQNAVLEDIFKKNDHDGDGFISSKEYNVYQHDEL
Download sequence
Identical sequences M3XVM3
ENSMPUP00000003123 ENSMPUP00000003123 XP_004769028.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]