SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003200 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003200
Domain Number 1 Region: 4-454
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 7.59e-116
Family 2-methylcitrate dehydratase PrpD 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003200   Gene: ENSMPUG00000003233   Transcript: ENSMPUT00000003265
Sequence length 471
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896942.1:1612447:1620691:1 gene:ENSMPUG00000003233 transcript:ENSMPUT00000003265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLKSVTESFARVIHGLAVGHLTDHVIQRSKRMILDTLGVGFLGTSTEVFHKASEYSKIY
SSNVSSSVWGRPELRLPPPYAAFVNGVAIHSMDFDDTWHPATHPSGAVLPVLMALTEALP
SSQKFSGLDMLLAFNVGIEVQGQLMHFSKEASDIPKRFHPPSVVGTLGSAAAASKLLRLS
MAKCQEALAIAVSHAGAPMANAATQTKPLHMGNAARHGMESAFLAMLGLQGNKQVLDMQT
GFGAFYANYSPQALPDLDSHTWLLGQQDVAFKRFPAHLATHWVADAAESVRKHLITDGAL
LPTDHVERIVLRIPDVQYVNRPFPDSEHAARHSFQYVACTTLLDGGITVPSFHKCQIDRP
QVRELLRKVELEHPRDNRPSFDTLYCEISVTLRDGATFTECSDTFYGHWRKPLSQEDLRE
KFRANASSMLSCDTVERLLEIIENLEDLEDCSVLTTLLKGPCPPEMVSKSI
Download sequence
Identical sequences M3XVV0
XP_004754458.1.14098 ENSMPUP00000003200 ENSMPUP00000003200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]