SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003335 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003335
Domain Number 1 Region: 167-421
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.13e-79
Family Eukaryotic proteases 0.00000000608
Further Details:      
 
Domain Number 2 Region: 50-160
Classification Level Classification E-value
Superfamily Kringle-like 2.05e-32
Family Kringle modules 0.0000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003335   Gene: ENSMPUG00000003367   Transcript: ENSMPUT00000003400
Sequence length 432
Comment pep:known scaffold:MusPutFur1.0:GL897046.1:1292232:1299158:-1 gene:ENSMPUG00000003367 transcript:ENSMPUT00000003400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLLACLLLCALVVSDSEGSHELHPGSSASNCHCLNGGTCVSYKYFSNIHRCNCPKKFQ
GEHCEIDTTETCFEGNGHSYRGKVDTDIIGRPCLAWNSATVLLKEYHALRPDALHLGLGK
HNYCRNPNNHRRPWCYVQVGLKQLVRECMVPECSSGKNPLTPEKAEFQCGQKALRPRFKI
IGGEFTTIENQPWFAAIYRKHHGGSVTYLCGGSLISPCWVLSATHCFINHPKKEDYIVYL
GRSKRNSRTPGEMMFEVEKLILHEDYNADSLAHHNDIALLKIRSNTDQCAHPSRSIQTIC
LPPVRGDANFGMSCEIAGFGKENDTDYLYPEQLKMTVVKLVSHQECQQPHYYGSEVTTKM
LCAADPQWETDSCQGDSGGPLVCSIQGRLTLTGIVSWGSGCAMKYKPGVYTRVSHFLPWI
HMHSRQQNGLTL
Download sequence
Identical sequences G9KH01
XP_004769430.1.14098 ENSMPUP00000003335 ENSMPUP00000003335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]