SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003357 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003357
Domain Number 1 Region: 463-661
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.92e-68
Family Hemopexin-like domain 0.00000000205
Further Details:      
 
Domain Number 2 Region: 90-219,392-447
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.86e-38
Family Matrix metalloproteases, catalytic domain 0.00000036
Further Details:      
 
Domain Number 3 Region: 278-335
Classification Level Classification E-value
Superfamily Kringle-like 2.14e-21
Family Fibronectin type II module 0.0000617
Further Details:      
 
Domain Number 4 Region: 338-394
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-21
Family Fibronectin type II module 0.0000733
Further Details:      
 
Domain Number 5 Region: 222-277
Classification Level Classification E-value
Superfamily Kringle-like 6.85e-20
Family Fibronectin type II module 0.0000528
Further Details:      
 
Domain Number 6 Region: 43-108
Classification Level Classification E-value
Superfamily PGBD-like 1.73e-19
Family MMP N-terminal domain 0.0000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003357   Gene: ENSMPUG00000003387   Transcript: ENSMPUT00000003422
Sequence length 661
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896910.1:8428552:8453667:1 gene:ENSMPUG00000003387 transcript:ENSMPUT00000003422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEARGARGALAGPLRVLCLLSCLWSRAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYG
CPKESCNLFVLKDTLKKMQKFFGLPQTGELDQNTIETMRKPRCGNPDVANYNFFPRKPKW
DKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHG
DGYPFDGKDGLLAHAFAPGPGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLF
NGREYTSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQG
TSYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTIGGNSEGAPCVFPFTFLGNK
HESCTSAGRSDGKLWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSEDPGA
LMAPIYTFTKNFRLSQDDIKGIQELYGASPDIDTGTGPTPTLGPVTPEICKQDIVFDGIS
QIRGEIFFFKDRFIWRTVTPQNKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNE
YWVYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMD
PGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKTDWLG
C
Download sequence
Identical sequences M3XWA7
ENSMPUP00000003357 XP_004744256.1.14098 ENSMPUP00000003357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]