SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003717 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003717
Domain Number 1 Region: 50-322
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.57e-82
Family Carbonic anhydrase 0.00000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003717   Gene: ENSMPUG00000003747   Transcript: ENSMPUT00000003785
Sequence length 357
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896906.1:2618249:2621584:-1 gene:ENSMPUG00000003747 transcript:ENSMPUT00000003785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPPSPSSSLNGHRSATPINQSSGICSSYTMRSQGFALTFLIVPLLVCGDSSDTWCYDSQD
PKCGPTHWKEMAPACGGPAQSPINIDLHLVQRDPTLGPFIFQGYNSAPASPWTLENNGHT
VVLHVDAGPQSLLEIRGAGLPLPAYRTLQLHFHWGGPGQAGSEHSLDGQRRPMEMHVVHM
NTRYQSLGEARSHPDGLAVLAVQLAEQDTDNANFSTLVSGLKNVSQRGASVNLTSTFPLA
SLLPGTSSLLRYYRYAGSLTTPGCQPAVVWTVFEDPVPIGRAQVAQFQTVPQAGLPGSSP
TRLRENFRPQQPLGGRRVLASFGASIRAAASVPTAFLAHVHGALLSLGLNLWLQQDP
Download sequence
Identical sequences M3XXB7
ENSMPUP00000003717 ENSMPUP00000003717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]