SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003719 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003719
Domain Number 1 Region: 29-141
Classification Level Classification E-value
Superfamily FKBP-like 3.73e-40
Family FKBP immunophilin/proline isomerase 0.00000097
Further Details:      
 
Domain Number 2 Region: 256-416
Classification Level Classification E-value
Superfamily TPR-like 6.48e-33
Family Tetratricopeptide repeat (TPR) 0.0000000603
Further Details:      
 
Domain Number 3 Region: 142-253
Classification Level Classification E-value
Superfamily FKBP-like 4.71e-27
Family FKBP immunophilin/proline isomerase 0.000000779
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003719   Gene: ENSMPUG00000003749   Transcript: ENSMPUT00000003787
Sequence length 456
Comment pep:known scaffold:MusPutFur1.0:GL897054.1:2353494:2482234:-1 gene:ENSMPUG00000003749 transcript:ENSMPUT00000003787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTDEGAKNNGENPAAAVAERGEDITSKKDRGVLKIVKRVGNSEETPMIGDKVYVHYKGK
LSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLP
KIPSNATLFFEIELLDFKGEDLFEDGGIIRRIKRKGEGYSNPNEGATVEIHLEGRCDGRM
FDCRDVVFIVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAE
LMYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEM
EYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEA
QLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQD
AKEEASKAMGKKTLEGVTNEKETESQVMEEKAGGHV
Download sequence
Identical sequences M3XXB9
ENSMPUP00000003719 ENSMPUP00000003719 XP_004770745.1.14098 XP_004770746.1.14098 XP_004770747.1.14098 XP_004770749.1.14098 XP_004770750.1.14098 XP_012900245.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]