SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003759 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003759
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily DNA clamp 4.89e-17
Family DNA polymerase processivity factor 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003759   Gene: ENSMPUG00000003789   Transcript: ENSMPUT00000003827
Sequence length 385
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896969.1:4910593:4919527:1 gene:ENSMPUG00000003789 transcript:ENSMPUT00000003827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCLVTGGNVKVLGKAVHSLSRIGEELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQPAAPGQEAPRCKILMKSFLAAFRSLAMVEKSVEKCCISLNGRSSRLVVQLHCRYGVRK
THNLSFQDCESLQAIFDPALCSHVLRAPARVLGEAVLPFPPALAEVTLGIGCGRRVILRS
YQEEEADSSVRAMVTEMSIGEEDFQQLQAQEGAAITFCLKEFRGLLSFAESANLSLSIHF
DAPGRPAIFAVKDSLLDGHFVLATMSESDLHSPEPHRLVPPLQAHSTPHLDDFANDDIDS
YMIAMETTVDSEGSRAGPSIPLSPGLRPPCSPGPDSEDNDAEPSTEPGTPPPKKFRSLFF
GSILSPAHSPPGPSPVLAEDSEGEG
Download sequence
Identical sequences M3XXF9
XP_004759565.1.14098 ENSMPUP00000003759 ENSMPUP00000003759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]