SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003817 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003817
Domain Number 1 Region: 44-300
Classification Level Classification E-value
Superfamily Carbonic anhydrase 6.41e-65
Family Carbonic anhydrase 0.00000872
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003817   Gene: ENSMPUG00000003847   Transcript: ENSMPUT00000003886
Sequence length 328
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897027.1:2042537:2047985:1 gene:ENSMPUG00000003847 transcript:ENSMPUT00000003886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVAARLSVPRALVLWAALGAAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWS
LCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVS
GGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNLSAASRGPNG
LAILSLFINVAGSSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGS
LSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNGRPLQPLAHRALR
GNRDPRHPERRCRGPNYRLHVDGAPHGR
Download sequence
Identical sequences M3XXL7
ENSMPUP00000003817 ENSMPUP00000003817 XP_004767468.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]