SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003823 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003823
Domain Number 1 Region: 2-420
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-154
Family ALDH-like 0.00000000000996
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003823   Gene: ENSMPUG00000003853   Transcript: ENSMPUT00000003892
Sequence length 424
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896927.1:3327503:3347684:-1 gene:ENSMPUG00000003853 transcript:ENSMPUT00000003892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERCRILLEAARIIRERKDEIATVETINNGKSIFEARWDIDTSWQCLEYYAGLAGSMAGE
HIQLPGGSFGYTRREPLGVCVGIGAWNYPFQIACWKSAPALACGNAMVFKPSPFTPVSVL
LLAEIYTEAGVPPGLFNVVQGGAATGQFLCQHPDVAKVSFTGSVPTGSKIMETAAKGIKS
VTLELGGKSPLIIFSDCDMENAVKGALMANFLTQGEVCCNGTRVFVQKEILDEFTREVVK
RTEKIKIGDPLLEDTRMGPLINRPHLQRVLGFVKLAKEQGAKVLCGGDVHVPEDPKLKDG
YYMRPCVLTNCRDDMTCVKEEIFGPVMSILPFDTEAEVLERANDTTFGLAAGVFTRDIQR
AHRVVAELQAGMCFINNYNVSPVELPFGGYKKSGFGRENGRVTVEYYSQLKTVCVEMGDV
ESAF
Download sequence
Identical sequences M3XXM3
ENSMPUP00000003823 XP_004751498.1.14098 ENSMPUP00000003823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]