SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004026 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000004026
Domain Number - Region: 60-116
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 0.0157
Family Molybdopterin synthase subunit MoaE 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004026   Gene: ENSMPUG00000004060   Transcript: ENSMPUT00000004099
Sequence length 196
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897134.1:1096100:1097194:-1 gene:ENSMPUG00000004060 transcript:ENSMPUT00000004099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CHRLFQSQEEGTMESFSSKSLALQAEKKLLSKMAGRSVAHLFMDETSSEVLDELYRVSKE
YTHSRPQAQRVLKDLIKVAVKVAVLHRSGCFGPGELDLAASFRQKLRQGAMTALSFGEVD
FTFEAAVLAGLLTECRDLLLELVACHLTPKSHGRIRHVFDHFSDTGLLTALYGPDFTQHR
TKICDGLRKLLDEGKL
Download sequence
Identical sequences M3XY75
ENSMPUP00000004026 ENSMPUP00000004026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]