SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004031 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004031
Domain Number 1 Region: 69-523
Classification Level Classification E-value
Superfamily Sema domain 2.35e-136
Family Sema domain 0.000000178
Further Details:      
 
Domain Number 2 Region: 519-545
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000244
Family Plexin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004031   Gene: ENSMPUG00000004065   Transcript: ENSMPUT00000004104
Sequence length 936
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897134.1:1111409:1126445:1 gene:ENSMPUG00000004065 transcript:ENSMPUT00000004104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRAPHFMPLLLLLLLLSLPHTQAAFPQDPLPLLTSDLQGTSPLSSWFRGLEDDAVVAEL
GLDFQKFLTLNRTLLVAARDHVFSFDLQAQEEGTGLVPNKYLTWRSQDMENCAVRGKLTD
ECHNYIRVLVPWDSQTLLACGTNSFSPVCRSYGITSLQQEGEELSGQARCPFDATQSNVA
VFAEGSLYSATAADFQASDAVVYRSLGPQPPLRSAKYDSKWLREPHFVHALEHGDHVYFF
FREVSVEDARLGRVQFSRVARVCKRDMGGSPRALDRHWTSFLKLRLNCSVPGDSTFYFDV
LQALTGPVNLYGRSALFGVFTTQTNSIPGSAVCAFYLDDIEHGFEGKFKEQRSLDGAWTP
VSEDRVPSPRPGSCAGVGVAALFPSSRDLPDEVLTFIKAHPLLDPAVPPATHQPLLTLTS
RALLTQLAVDGRAGPYRNTTVLFLGSNDGTVLKVLPPGGPSGGREPILLEEINAYSPSRC
SGKRAAQMARRVIGLELDTEGHRLFVAFSGCIIYLPLSRCARHGACRRSCLASQDPYCGW
HSSRGCVDIRGPGGTDVDPTGNQEFTEHSDCQDGATGSQSGTGDSAYGVRRDLPPASASL
SVPIPLLLACAAAAFALGASVSGLLVSCACRRAHRRRSKDVETPGLPRPLSLRSLARLHG
AGPELPPSKDGDSAQPPQLYTTFLPPPDGVAPPEVACLPTPESTPELPVKHLRHAGGPWE
WNQNGNNAKEGPGRARGGSAAGGPAPRVLVRPPPPGCPGQAVEVTTLEELLRYLHGPQPS
RKGAEPPAVAALTSRALPPEPVPTPAPSLFAGSSLLPRECGLPLRLDVPPEGKCAAPSTR
PALSAPAPRLGVGSSRRMPFPTHRAPPALLTRVPSGGPSRYCGGPGRHLLYLGRPEGYRG
RALKRVDVEKTQLPPKPPLVSPSSQPAVPNGSHFNF
Download sequence
Identical sequences M3XY80
ENSMPUP00000004031 ENSMPUP00000004031 XP_004776814.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]