SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004294 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004294
Domain Number 1 Region: 4-285
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 4.97e-108
Family Inorganic pyrophosphatase 0.0000000585
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004294   Gene: ENSMPUG00000004327   Transcript: ENSMPUT00000004370
Sequence length 289
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897046.1:4439567:4478010:1 gene:ENSMPUG00000004327 transcript:ENSMPUT00000004370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGFSSEERAAPFTLEYRVFLKNEKGQYISPFHDVPIYADKDVFHMVVEVPRWSNAKMEI
ATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPI
DVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKP
GYLEATVDWFRRYKVPDGKPENQFAFNAEFKDKDFAIDIIKSTHDHWRALVTKKTDGKGI
SCMNTTVSGSPFKCDPDAAKAIVDALPPPCESACTIPTDVDKWFHHQKN
Download sequence
Identical sequences M3XYZ3
XP_004769583.1.14098 ENSMPUP00000004294 ENSMPUP00000004294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]