SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004307 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004307
Domain Number 1 Region: 11-628
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 3.27e-229
Family Aconitase iron-sulfur domain 2.62e-16
Further Details:      
 
Domain Number 2 Region: 633-887
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 5.49e-84
Family LeuD-like 0.000000000366
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004307   Gene: ENSMPUG00000004340   Transcript: ENSMPUT00000004383
Sequence length 889
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897009.1:6769386:6820265:-1 gene:ENSMPUG00000004340 transcript:ENSMPUT00000004383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNPFAHLVEPLDLAQPGKKFFNLNKLKDSRYERLPFSIRVLLEAAVRNCDQFLVKKNDI
ENILNWNVMQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGDPEKINPICPA
DLVIDHSIQVDFNRRTDSLQKNQDLEFERNRERFEFLKWGSQAFRNMRIIPPGSGIIHQV
NLEYLARVVFDHDGYYYPDSLVGTDSHTTMIDGLGVLGWGVGGIEAEAVMLGQPISMVLP
QVIGYKLVGNPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMC
PEYGATAAFFPVDDVSIKYLVQTGRDEEKVKQMKKYLQAVGMFRDFSDPSQDPDFAQVVE
LNLGTVVPCCSGPKRPQDKVAVTDMKKDFESCLGAKQGFKGFQVALDHHNDHKTFIYNNS
EFTLTHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVNAGLNVKPYIKTSLSPGSGVVTY
YLRESGVMPYLSQLGFDVVGYGCMTCIGNSGPLPDPVVEAITQGDLVAVGVLSGNRNFEG
RVHPNTRANYLASPPLVIAYAIAGTIRINFEKEPLGVNAKGEQVFLKDIWPTRDEIQAVE
RQYVIPGMFKEVYQKIETVNESWNALAAPSDKLYCWNPKSTYIKSPPFFENLTLALQPPK
SIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAIMA
RGTFANIRLLNKFLNKQAPQTIHLPSGEILDVFDAAEQYQQAGLPLIILAGKEYGSGSSR
DWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGETADTLGLTGRERYTIIIP
ENLTPRMKVQVKLDTGKTFQAIMRFDTDVELTYFHNGGILNYMIRKMAK
Download sequence
Identical sequences M3XZ06 U6CVN2
ENSMPUP00000004307 XP_004765422.1.14098 XP_012918367.1.14098 ENSMPUP00000004307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]