SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004332 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004332
Domain Number 1 Region: 296-398
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.54e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 107-161,188-203,231-249
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.68e-16
Family BphP N-terminal domain-like 0.051
Further Details:      
 
Domain Number 3 Region: 25-108
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000236
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 4 Region: 499-664
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.000000553
Family Tetraviridae-like VP 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004332   Gene: ENSMPUG00000004365   Transcript: ENSMPUT00000004408
Sequence length 719
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897134.1:1348147:1382494:1 gene:ENSMPUG00000004365 transcript:ENSMPUT00000004408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKP
DKLTILRMAVSHMKSLRGTGNTSTDGTYKPSFLTDQELKHLILEAADGFLFIVSCETGRV
VYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKK
EGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSMNRLSFVRNRCRNGLGSVKDGEPHFVVV
HCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQPTEFISR
HNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVM
FRFRSKNREWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLGP
TANLPLEMGSGQLASRQQQQQTELDVVSARDGLAGYSHSQPVTTTGPEHSKPLEKTDGLF
AQDRDPRFSEIYSNINTDQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRSSGLAPPV
TIIQPSASAGQMLAQISRHSNAPQGAAPAWTPSTRPGFSAQVATQATAKTRSSQFGVGNF
QTPSSFSSMSLPGASTASPGAAAYPSLTSRGSNFAPETGQTTGQFQTRTAEGVGVWPQWQ
GQQPHHRSSSNEQHVQQSSAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFSSFSE
Download sequence
Identical sequences M3XZ31
ENSMPUP00000004332 ENSMPUP00000004332 XP_012903416.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]