SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004336 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004336
Domain Number 1 Region: 84-141
Classification Level Classification E-value
Superfamily Kringle-like 5.71e-19
Family Fibronectin type II module 0.0032
Further Details:      
 
Domain Number 2 Region: 203-248
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000171
Family Fibronectin type II module 0.0023
Further Details:      
 
Domain Number 3 Region: 53-96
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000166
Family Fibronectin type II module 0.0029
Further Details:      
 
Domain Number 4 Region: 143-194
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000685
Family Fibronectin type II module 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004336   Gene: ENSMPUG00000004369   Transcript: ENSMPUT00000004412
Sequence length 248
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897027.1:2505227:2518481:-1 gene:ENSMPUG00000004369 transcript:ENSMPUT00000004412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPWSSYLLGWTTFVLYSFETSGNLPLNLNQLPKDHMTSPFPWIGSRNHQKDSCVFPFIY
KGSSYFSCIKTNSLSPWCATRAIYDGQWKYCMVDDYPRCIFPFIYRGRSHNTCIMEGSFF
GRLWCSVTSSFDEKQQWKYCEINEYGGNSFSKPCIFPSIYRNSTISECVENESNKLWCPT
TENMDADGKWSLCADTRISSLVPGFPCHFPFNYKNKNYFNCTNKGTKQNLMWCATSYDYD
RDRTWVYC
Download sequence
Identical sequences M3XZ35
ENSMPUP00000004336 ENSMPUP00000004336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]