SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004354 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004354
Domain Number 1 Region: 8-125
Classification Level Classification E-value
Superfamily Cgl1923-like 0.000000405
Family Cgl1923-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004354   Gene: ENSMPUG00000004387   Transcript: ENSMPUT00000004430
Sequence length 264
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896906.1:5086381:5109962:-1 gene:ENSMPUG00000004387 transcript:ENSMPUT00000004430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVPCGESVPDLAGYTFLMPAVSVGNVGQLAMDLIISTLNMCKIGYFYTDCLVPMVGNNP
YATAEENSTELSINAEIYALPSKKLVALQLRSIFIKYKSKPFCEKLLSWVKSSNCAKVIV
LSSSHSYHRNDLQLRSTPFRYLLTPYVQKSIQTKITSLNWEEMEKSPCIPEINDSEFCIR
IPGGGITKTLYDEGCSKEIAMVILLKFVSEGDNIPDALGLVEYLNEWLQILKPCCDDPTA
SALRWKMPSSWRLLFGSGLPPALF
Download sequence
Identical sequences M3XZ53
XP_004742732.1.14098 ENSMPUP00000004354 ENSMPUP00000004354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]