SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004371 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004371
Domain Number 1 Region: 67-123
Classification Level Classification E-value
Superfamily Kringle-like 2.86e-18
Family Fibronectin type II module 0.0028
Further Details:      
 
Domain Number 2 Region: 36-78
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000106
Family Fibronectin type II module 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004371   Gene: ENSMPUG00000004404   Transcript: ENSMPUT00000004447
Sequence length 128
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897027.1:2554131:2562115:1 gene:ENSMPUG00000004404 transcript:ENSMPUT00000004447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSPVSWLPLAVCVGGLKAELITHLHPPVLEFVNSTCVFPFMYGDSMYYNCISLHSDYDW
CSLDKKFQGRWRYCTGKDPPKCAFPFLYRKKLFYECTKNGYVLNRSWCSLTKNYNQDGKW
KQCSPFGL
Download sequence
Identical sequences M3XZ70
ENSMPUP00000004371 ENSMPUP00000004371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]