SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004404 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004404
Domain Number 1 Region: 40-506
Classification Level Classification E-value
Superfamily Sema domain 2.88e-131
Family Sema domain 0.0000179
Further Details:      
 
Domain Number 2 Region: 1351-1478,1674-1863
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.88e-51
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 951-1038
Classification Level Classification E-value
Superfamily E set domains 2.42e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.076
Further Details:      
 
Domain Number 4 Region: 1036-1140
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000216
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.055
Further Details:      
 
Domain Number 5 Region: 509-561
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000144
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 6 Region: 854-950
Classification Level Classification E-value
Superfamily E set domains 0.0000000000754
Family Other IPT/TIG domains 0.019
Further Details:      
 
Domain Number 7 Region: 1137-1226
Classification Level Classification E-value
Superfamily E set domains 0.0000021
Family E-set domains of sugar-utilizing enzymes 0.067
Further Details:      
 
Domain Number 8 Region: 808-840
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000419
Family Plexin repeat 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000004404
Domain Number - Region: 653-685
Classification Level Classification E-value
Superfamily Plexin repeat 0.0706
Family Plexin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004404   Gene: ENSMPUG00000004437   Transcript: ENSMPUT00000004480
Sequence length 1893
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896904.1:7984979:8338019:1 gene:ENSMPUG00000004437 transcript:ENSMPUT00000004480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAMPWNWTCLLSHLLMVGMGSSTLLPRQPPPPSPKRSFVTFRGEPAEGFNHLVVDERTG
HIYLGAVNRIYKLSSDLKVLVTHQTGPDEDNPKCYPPRIVQTCNEPLTTTNNVNKMLLID
YKENRLIACGSLYQGICKLLRLEDLFKLGEPFHKKEHYLSGVNESGSVFGVIVSYSNLDD
KLFIATAVDGKPEYFPTISSRKLTKNSEADGMFAYVFHDEFVASMIKIPSDTFTVIPDFD
IYYVYGFSSGNFVYFLTLQPEMVSPPGSTTKEQVYTSKLVRLCKEDTAFNSYVEVPIGCE
RGGVEYRLLQAAYLSKAGAVLARTLGVRPEDDLLFTVFSKGQKRKMKSLDESALCIFILK
QINDRIKERLQSCYRGEGTLDLAWLKVKDIPCSSALLTIDDNFCGLDMNAPLGVSEMVRG
IPVFTEDRDRMTSVIAYVYKNHSLAFVGTKSGKLKKIRVDGPRGNALQYETVQVVEPGPV
LRDMAFSKDHEQLYIMSERQLTRVPVESCGQYRSCSECLGSGDPHCGWCVLHNTCTRKER
CARSREPRRFASEMKQCVRLTVHPSNISVSQYNVLLVLETYNVPELSAGVNCTFEDLSET
DGLVVGNQIQCYSPAAKEVPRIITENGDHHVVQLQLKSKETGMTFASTSFVFYNCSVHNS
CLSCVESPYRCHWCKYRHVCTHDPKTCSFQEGRVKLPEDCPQLLRVDKLLVPVEVIKPIT
LKAKNLPQPQSGQRGYECILNIQGVEQRVPALRFNSSSVQCQNTSYSYEGMEINNLPVEL
TVVWNGHFNIDNPAQNRVHLYKCGAMRESCGLCLKADPDFQCGWCQSQGQCTLRQHCPVH
ESQWLELSGANSRCTNPRITEIIPVTGPREGGTKVTIRGENLGLEFRDIASHVKVAGVDC
SPLVDGYIPAEQVSNIKRQLQTSQRKGYVEICVAVCRPEFMARSSQLYYFMTLTLSDLKP
RRGPMSGGTQVTITGTNLNAGSNVVVMFGKQPCLFHRRSPSYIVCNTTSSEEVLEMKVMV
QVDKASIHQDLFFQYVEDPTIVRIEPEWSIVSGNTPIAVWGTHLDLIQNPQIRAKHGGKE
HINLCEVLNATEMTCQAPALALGPDHQSDLTERPEEFGFILDNVQSLLILNKTNFTYYPN
PVFEAFGPSGILELKPGTPIILKGKNLIPPVAGGNVKLNYTVLVGEKPCAVTVSDVQLLC
ESPNLIGRHKVMARVGGMEYSPGMVYVAPDSPLSLPAIVSIAVAGGLLVIFIVAVLIAYK
RKSRESDLTLKRLQMQMDNLESRVALECKEAFAELQTDIHELTSDLDGAGIPFLDYRTYT
MRVLFPGIEDHPVLRDLEVPGYRQERVEKGLKLFAQLINNKVFLLSFIRTLESQRSFSMR
DRGNVASLIMTVLQSKLEYATDVLKQLLADLIDKNLESKNHPKLLLRRTESVAEKMLTNW
FTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLV
LSCVNPDSANSPEVPVKILNCDTITQVKEKILDAIFKNVPCSHRPKAADMDLEWRQGSGA
RMILQDEDITTKIENDWKRLNTLAHYQVPDGSVVALVSKQVTAYNAVNNSTVSRTSASKY
ENMMRHTGSPDSLRSRTPMITPDLESGVKMWHLVKNHEHGDQKEGDRGSKMVSEIYLTRL
LATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHGIHDPHVRHTWKSN
CLPLRFWVNMIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYA
KDIPSYKNWVERYYSDIGKMPAISDQDMNAYLAEQSRMHMNEFNAMSALSEIFSYVGKYS
EEILGPLDHDDQCGKQKLAYKLEQVITLMSLDS
Download sequence
Identical sequences M3XZA3
ENSMPUP00000004404 ENSMPUP00000004404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]