SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004597 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004597
Domain Number 1 Region: 567-809
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.34e-82
Family Eukaryotic proteases 0.0000000146
Further Details:      
 
Domain Number 2 Region: 366-460
Classification Level Classification E-value
Superfamily Kringle-like 7.73e-39
Family Kringle modules 0.0000135
Further Details:      
 
Domain Number 3 Region: 90-183
Classification Level Classification E-value
Superfamily Kringle-like 1.28e-36
Family Kringle modules 0.0000248
Further Details:      
 
Domain Number 4 Region: 272-359
Classification Level Classification E-value
Superfamily Kringle-like 1.72e-36
Family Kringle modules 0.0000218
Further Details:      
 
Domain Number 5 Region: 183-266
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-35
Family Kringle modules 0.0000101
Further Details:      
 
Domain Number 6 Region: 474-562
Classification Level Classification E-value
Superfamily Kringle-like 3.87e-33
Family Kringle modules 0.00000899
Further Details:      
 
Domain Number 7 Region: 19-100
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 1.06e-19
Family Hairpin loop containing domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004597   Gene: ENSMPUG00000004632   Transcript: ENSMPUT00000004676
Sequence length 810
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897057.1:1557398:1595033:1 gene:ENSMPUG00000004632 transcript:ENSMPUT00000004676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELKEVLLLLLLFLKSGRGDPLDDYVSTQGASVLSFTKKQLWAGSVQECAGKCEEEAEFI
CRSFQYHSKEQQCVIMAENSKSSAILRMRDVVLFEKKIYLSECKTGNGKAYRGTMSKTKN
GVTCQKWSDNSPHKPNFTPQKYPREGLEENYCRNPDNDEKGPWCYTTDPDQRFDYCNIPE
CEEECMHCSGENYEGKISKTMSGLECQAWNSQTPHAHGYIPSKFPNKNLKMNYCRNPDGE
PRPWCFTTDPSKRWEFCDIPRCATPPPSSGPTYQCLKGRGESYRGTVSITVSGHTCQRWS
EQTPHKHNRTPENFPCKDLVENYCRNPDGESAPWCYTTDSEVRWEHCRIPSCESPPLTSE
PSDAAVPPEQTPVVQECYHGNGQSYRGTSSTTVTGKKCQSWSSMTPHRHEKTPQHFPDAG
LTMNYCRNPDGDKSPWCYTTDPSVRWEFCNLKKCLDTAESDTHSPTVPQAPSGNDPSESD
CMFGSGKGYRGKKATTVLGVPCQEWAAQEPHSHSIFTPETNPRAGLEKNYCRNPDGDVNG
PWCYTMNPRKLFDYCDIPQCASGSFDCGKPQVEPKKCPGRVVGGCVANPHSWPWQISLRT
RFGKHFCGGTLISPEWVLTAAHCLERSSRPASYKIILGAHRELNLESDVQEIEASKLFLE
PTRADIALIKLSSPAVITSKVIPACLPSANYVVADRTLCYITGWGETQGTFGAGLLKEAQ
LPVIENKVCNRYEYLNGRVKSTELCAGNLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSW
GLGCARPNKPGVYVRVSRFVTWIEGIMRNN
Download sequence
Identical sequences M3XZU6
ENSMPUP00000004597 XP_004770898.1.14098 ENSMPUP00000004597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]