SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004621 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004621
Domain Number 1 Region: 2-432
Classification Level Classification E-value
Superfamily ALDH-like 6.94e-155
Family ALDH-like 0.000000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004621   Gene: ENSMPUG00000004658   Transcript: ENSMPUT00000004702
Sequence length 434
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896976.1:393610:416168:-1 gene:ENSMPUG00000004658 transcript:ENSMPUT00000004702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRAAYEAFCSWRGVSAKERSSLLRKWYDLMIQNKDDLARIITAESGKPLKEAQGEVIYSA
LFLEWFSEEARRIYGDIIYTPTRDRRALVLKQPLGVAAVITPWNFPSAMITRKVGAALAA
GCTVVVKPAEHTPFSALALAELANQAGIPPGVYNVIPCSRKKAKEVGEALCTDPLVSKIS
FTGSTATGKVLLHHAAGSVKRVSMELGGHAPFIVFDSANVDQAVAGAMASKFRNSGQTCV
CSNRFLVQRGIHDSFVKKFAEAIQTNLRVGNGFEERTTQGPLIDEKAVEKVETHVSDAVS
KGATIVTGGKRHQLGKNFFEPTLLSNVTGDMLCAHEETFGPLAPVIKFDTEEEAVAIANA
TDVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGI
DEYLELKYVCFGGL
Download sequence
Identical sequences M3XZX0
ENSMPUP00000004621 ENSMPUP00000004621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]