SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004663 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004663
Domain Number 1 Region: 67-201
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 5.89e-40
Family Band 7/SPFH domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000004663
Domain Number - Region: 208-323
Classification Level Classification E-value
Superfamily ALDH-like 0.0255
Family ALDH-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004663   Gene: ENSMPUG00000004700   Transcript: ENSMPUT00000004744
Sequence length 356
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896918.1:870339:874393:-1 gene:ENSMPUG00000004700 transcript:ENSMPUT00000004744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARAARGTGALLLRGSVQASGRAPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILE
PGLNILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVE
DPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNASIVDAINQAADCWGIRCLRYEIKDI
HVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQAQILASEAEKAEQINQA
AGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAEQYVSAFSKLAKDSNTILLPS
NPGDVTSMVAQAMGVYGALTKAPVPGAKDSVSSGSSRDVQGTDGSLDEEFDRVKLS
Download sequence
Identical sequences M3Y012
ENSMPUP00000004663 XP_004747550.1.14098 ENSMPUP00000004663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]