SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004848 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004848
Domain Number 1 Region: 283-430
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.46e-44
Family Mannose 6-phosphate receptor domain 0.000000467
Further Details:      
 
Domain Number 2 Region: 589-724
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.62e-40
Family Mannose 6-phosphate receptor domain 0.00026
Further Details:      
 
Domain Number 3 Region: 107-279
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.27e-38
Family Mannose 6-phosphate receptor domain 0.000000176
Further Details:      
 
Domain Number 4 Region: 1329-1470
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.58e-36
Family Mannose 6-phosphate receptor domain 0.00045
Further Details:      
 
Domain Number 5 Region: 1479-1610
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.31e-35
Family Mannose 6-phosphate receptor domain 0.000000245
Further Details:      
 
Domain Number 6 Region: 721-886
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.57e-34
Family Mannose 6-phosphate receptor domain 0.0018
Further Details:      
 
Domain Number 7 Region: 1032-1182
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.27e-33
Family Mannose 6-phosphate receptor domain 0.0009
Further Details:      
 
Domain Number 8 Region: 1186-1325
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.27e-31
Family Mannose 6-phosphate receptor domain 0.00015
Further Details:      
 
Domain Number 9 Region: 1615-1760
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.06e-30
Family Mannose 6-phosphate receptor domain 0.001
Further Details:      
 
Domain Number 10 Region: 434-580
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.98e-30
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 11 Region: 2096-2243
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.22e-29
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 12 Region: 1950-2089
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.22e-28
Family Mannose 6-phosphate receptor domain 0.0016
Further Details:      
 
Domain Number 13 Region: 2-104
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 5.76e-25
Family Mannose 6-phosphate receptor domain 0.00000325
Further Details:      
 
Domain Number 14 Region: 896-1041
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.66e-23
Family Mannose 6-phosphate receptor domain 0.0028
Further Details:      
 
Domain Number 15 Region: 1767-1860,1909-1952
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.57e-22
Family Mannose 6-phosphate receptor domain 0.0023
Further Details:      
 
Domain Number 16 Region: 1859-1908
Classification Level Classification E-value
Superfamily Kringle-like 5.14e-17
Family Fibronectin type II module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004848   Gene: ENSMPUG00000004888   Transcript: ENSMPUT00000004932
Sequence length 2457
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897057.1:1846728:1925553:-1 gene:ENSMPUG00000004888 transcript:ENSMPUT00000004932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIYKISICGNVDVAHCGPLSAICMYDLKTSTYHSVGDSSSKTVTRSLLEFNTTESCKQSP
NHRIQSSITFLCGKTLGTPEFVTATDCVHYFEWRTTAACKKETFKANKEVPCYAFDGELK
KHDLNPLIKISGAYLVDDSDPDTSLFINVCRDIDSLRDPSPQLRGCPAGTAACLVRGDQA
FDVGQPKEGLKLVNKDRLVLSYVKEGARELDFCDGHSPAVTITFVCPSERRETCRATWRP
LSTDLTGQQTTCVLKGTIPKLTAKSNCRYEIEWITEYACHRDYLESQTCSLTSEQHDITV
DLQPLRQNRGPSSSYYTSDGKEYMFYLNVCGEVEVPFCSKKDAAVCQVKKAEPSQIKVAG
KYQNQTLRYSDGDLTLIYSGGEKCSSGFQRMSVINFECNKTAVNDGQGVPVFTGEVDCTY
FFTWDTKYACVKEKEDLLCSVTDGKKRYDLSALARHSEVEQNWEAVDGSEGETEKKHFFV
NICHRVLQEGQARGCPEDAAACSVDKDGFKSLGKFVSSPTKEKGNLQLSYTDGSDCGHKK
ITTNITLICKPGDLESAPVLRTSEDDGCFYELEWHTAAACVLSKTEGENCTVFDSQAGFS
FDLSPLTKKNGAYRVNTDKYEFYINVCGAVSLSSCPPGSGACQLAKIGNKAWNLGLSNAK
LSYYDGMIQLNYKDGTPYNNEKHTPRATLITFLCDREAGVGVPEYQEEDNSTYNFRWYTS
YACPVEPLECVVTDPSTMEQYDLSSLAKSEGGRGGNWYAMDNAGEHSSWRKYYINVCRPL
NPVPGCDRYASVCQMRYKNEQGSFSEVASISNLGVAKGGPTVEDSGSLLIEYVNGSACTT
SDGRLTTYTTRIHLVCSRGSLNPHPIFSLSWECVVSFLWNTEAACPIQITTDTDQACSIR
DPNSGFVFDLNPLNTSQGYVVPGIGKTFVFNVCGAMPVCGTIDGKPASGCEAEIETEDLK
NLKPEKPVGLEKSLQLSTEGFITLTYKGPLSPATGTADTFIIRFVCNDDVYPGNPTFLHQ
DIDSGRGIRNTFFEFETALACVPSPVDCQVTDDAGNEYDLSGLSRVRKPWTAVDTSADGR
KRTFYLSVCNPLPYIPGCHGSAVGSCLVSEDNSWNLGVVQISPQAAANGSLSIVYVNGDK
CGNQRFSTRIMLECAQTSGSPTFQLLDDCEYVFVWRTVEACPVIRVEGDNCEVKDPRHGN
LYDLKPLAANDTVVTAGEYAYYFRVCGTLSSKVCSTSDKSKAISSCQEKRGPEGFQKVAG
LLTQKLTYENGLLKMNYTGGDTCHKVYQRSTTIFFYCDRSTQRPVFLRETSDCSYLFEWR
TQYACAPFDVTECSFKDGAGNTFDLSSLARYSDNWEAVTRTGATEHYLINVCKSLSPQAG
SEPCPPEAAACLLSGSKPVNLGRVSEGPQWGDGATVLKYVDGDLCPDQIRKKSTTIRFTC
SESQVNSRPMFISAVEDCEYTFSWPTPAACPVRSNVHDNCQVTNPATGHLFDLSSLSGRV
GHTAAYSEKGLVFISICDDNENCAPGVGACFGQTRISVGKANKRLTYVDQVLQLVYEGGS
PCPSKSGLTYKSVISFVCRPEVGPTNRPMLISLDKQTCTLFFSWHTPLACEQVTECSVRN
GSSIIDLSPLIHRTGGYEAYDESEDETSDTGPDFYINICQPLNPMHGVPCPAGAAVCKVP
VDGPPIDIGRVTGPPILNPIANEVYLNFESSTPCLADKHFNYTSLIAFHCRRGVSMGTPM
LLRTSDCDFVFGWETPLVCPDEVKVDGCSLTDEQLRYSFNLSSLSKSTFKVTRDSRTYSI
GVCTAAAGPDEGGCKDGGVCLLSGSKGASFGRLASMRLDYRHQDEAVILSYANGDNCPPE
TEEGDPCVFPFIFNGKSYEECVLEGRARLWCSTTANYDRDHEWGFCRHSNSHRMSAIIFR
CDEDADIGRPQVFSEVRGCEVTFEWKTKVVCPPKKMECKFIQKHKTYDLRLLSSLTGSWF
FVHEGVSYYINLCQKIYKGPLDCSDRASICKKSASGVVQVLGLVHTQKLDVLDEKVIVTY
SKGYQCGENKTASAVIELTCAKTVGRPSFMRFDIDSCTYYFSWDSRAACAVKPQEVQMVN
GTITNPVNGKSFSLGDIYFKLFSASGDMRTNGDKYLYEIQLSSITSSRNPACSGANICQV
KPNDQHFSRKVGTSDRTRYYIQDGDLDVVFASSSKCGKDKTKSVSSTIFFHCDPLVKDGI
PEFSHETADCQYLFSWYTSAVCPLGVGLDGDGTGEDMPEHKGLSERSQAVGAVLSLLLVA
LTGCLLTLLLYKKERRELVVSRLTGCCRRSANVSYKYSKVNKEEEADEDETDWLMEEVRA
PAPRPGKEAQENGHITTKSVKAEALTSLHGDEQDSEDEVLTIPEVKVHSGRGTGAAGVPQ
GRVPQRSGLRESAEGAGVPLRGDRARRGKARPAPPKTVNSGSLASFHDDSDEDLLHI
Download sequence
Identical sequences M3Y0J7
ENSMPUP00000004848 ENSMPUP00000004848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]