SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005073 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005073
Domain Number 1 Region: 39-534
Classification Level Classification E-value
Superfamily Sema domain 3.92e-149
Family Sema domain 0.000000191
Further Details:      
 
Domain Number 2 Region: 530-574
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000593
Family Plexin repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005073   Gene: ENSMPUG00000005111   Transcript: ENSMPUT00000005158
Sequence length 690
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897062.1:1135010:1145667:-1 gene:ENSMPUG00000005111 transcript:ENSMPUT00000005158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTPRAPPPRPAPLLLLLLLGGANGLFPEEPPPLSVAPRDYLNHYPVFVGSGPGRLTPAE
GPDDLHIQRVLRVNRTLFIGDRDNLYRVELEPPTATELRYQRKLTWRSNPSDINVCRMKG
KQEGECRNFVKVLLLRDESTLFVCGSNAFNPVCANYSMDTLQPLGDNISGMARCPYDPKH
ANVALFSEGMLFTATVTDFLAIDAVIYRSLGDRPTLRTVKHDSKWFKEPYFVHAVEWASH
IYFFFREIAMEFNYLEKVVVSRVARVCKNDLGGSPRVLEKQWTSFLKARLNCSVPGDSHF
YFNVLQAVTGVVSLGGRPVVLAVFSTPSNSIPGSAVCAFDMTQVAAVFEGRFREQKSPES
IWTPVPEDQVPRPRPGCCAAPGMQYNASSAFPDEILNFVKTHPLMDEAVPSLGHAPWIVR
TLMRHQLTRVAVDVGAGPWGNHTVVFLGSEVGTVLKFLIWPNASTSGTTGPSVFLEEFET
YRPDRCRGQRCGRSGDGEAGRRLLSLELDTASGGLLAAFPRCVVRVPVARCQQYSGCMKN
CIGSQDPYCGWAPDGSCVFLSPGTRGTFEQDVSGASTSGLGDCTGLLRASLAEERAGLVS
VNLLVTSSVAAFVVGAVVSGFSVGWYVGLRERRELARRRDKVCVCVCRGGPRVQCTCLCA
RWWPQRPGRWLTRRRGFQKARGPPRCRLGI
Download sequence
Identical sequences M3Y172
ENSMPUP00000005073 ENSMPUP00000005073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]