SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005082 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005082
Domain Number 1 Region: 307-393
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000128
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00094
Further Details:      
 
Domain Number 2 Region: 146-198
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000102
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.031
Further Details:      
 
Domain Number 3 Region: 45-97
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000641
Family HLH, helix-loop-helix DNA-binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005082   Gene: ENSMPUG00000005118   Transcript: ENSMPUT00000005167
Sequence length 593
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897027.1:3193158:3213311:-1 gene:ENSMPUG00000005118 transcript:ENSMPUT00000005167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPYPSSGSGGEVKCGGGRGRSVPWDFLPGLVVKAPPGPCLQAQRKEKSRNAARSRRGK
ENLEFFELAKLLPLPGAISSQLDKASIVRLSVTYLRLRRFAALGAPPWGLRAAGPPAGLA
PGHRGRVALVSEVFEQHLGGHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVELTGS
SVFDYIHPGDHSEVLEQLGLRAPTPGPPTPPSVPSSSSSSSSSSLADTPEIEASATEVPP
FSRVQERSFFIRMKSTLTKRGLHVKASGYKVIHVTGRLRARSLGLVALGHTLPPAPLAEL
PLHGHMIVFRLSLGLTILACESRVSDHMDLGPSELVGRSCYQFVHGQDAARIRQSHLDLL
DKGQVMTGYYRWLQRAGGFVWLQSVATVAVSGKSPGERHVLWVSYVLSQAEGGQTPLDAF
QLPASVACEDTSSPEPEPTEPEPPGEGKQAAPLDKDEAPRSRGKRIKVEPGPGQAKDPED
SGDEESSGHLALPRPEFTSVIRAGALKQDLVRPWGLGPPGDPSPSLLHAGFLPPVVRGLC
TPGTIRYGPAELGLVYPHLQRLAPGPTLPEAFYPTLGLSYPGTTGTRVQRKGD
Download sequence
Identical sequences M3Y181
XP_004767562.1.14098 XP_004767563.1.14098 XP_012919547.1.14098 ENSMPUP00000005082 ENSMPUP00000005082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]