SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005199 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000005199
Domain Number - Region: 123-173
Classification Level Classification E-value
Superfamily Cgl1923-like 0.00798
Family Cgl1923-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005199   Gene: ENSMPUG00000005237   Transcript: ENSMPUT00000005287
Sequence length 265
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897134.1:1829010:1840358:1 gene:ENSMPUG00000005237 transcript:ENSMPUT00000005287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVT
DRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYV
SGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFD
ACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQ
RSLSCRRQEDSRVMVYSALRIPPED
Download sequence
Identical sequences A0A1U7R9X9 A0A1U7TNP3 A0A250YDX9 A0A2K6F6W4 D2HBU9 L8Y2Y7 M3XG97 M3Y1J8
XP_002715647.1.1745 XP_003990614.1.62641 XP_004404252.1.74151 XP_004436007.1.5094 XP_005084313.1.91757 XP_005378746.1.28644 XP_006168548.1.99106 XP_006728379.1.47382 XP_006902282.1.29581 XP_007088111.1.5354 XP_008061624.1.4292 XP_012514268.1.63892 XP_014940322.1.86478 XP_019288463.1.44245 XP_020011362.1.5219 XP_021543728.1.83697 ENSAMEP00000001853 ENSMPUP00000005199 ENSAMEP00000001853 ENSFCAP00000012923 ENSMPUP00000005199 9685.ENSFCAP00000012923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]