SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005224 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005224
Domain Number 1 Region: 440-770
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.24e-106
Family PDEase 0.00000122
Further Details:      
 
Domain Number 2 Region: 172-273
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.01e-17
Family Flavin-binding PAS domain 0.052
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000005224
Domain Number - Region: 44-112
Classification Level Classification E-value
Superfamily CheY-like 0.00299
Family CheY-related 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005224   Gene: ENSMPUG00000005262   Transcript: ENSMPUT00000005312
Sequence length 782
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897022.1:2702187:2829964:-1 gene:ENSMPUG00000005262 transcript:ENSMPUT00000005312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEHMVGVRKVSSAEVRIGPMRLTQDPIQVLLIFAKEDSQSDGFWWACDRAGYRCNIARTP
ESALECFLDKHHEIIVIDHRQTRNFDAEAVCRSIRATNPSEHTVILAVVSQASGDREEAS
VLPLLHAGFNRRFMENNSIIACYNELVQIEHGEVRSQFKLRFRACNSVFTALDHCHEAIE
ITSDDHVIQYVNPAFERMMGYHKGELLGKELAELPKSDKNRADLLDTINTCIKKGKEWQG
VYYARRKSGDSIQQHVKITPVIGQGGKIRHFVSLKKLCCTTDNNKQLHKVHRDSGDNSQT
APSYMYCPSERGEEVVVRSNENRAFISPSLQNRRYPSMARIHSMTIEAPITKVINIINAA
QENSPVTVAEALDRVLEILRTTELYSPQLGTKDEDPHTSDLVGGLMTDGLRRLSGNEYVF
TKNVHQSHSHLAMPITINDVPPCIAQLLDNEESWEFNIFELEAVTHKRPLVYLGLKVFSR
FGVCEFLHCSETTLRAWLQVIEANYHSSNAYHNSTHAADVLHATAFFLGKERVKGSLDQL
DEVAALIAATVHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDSKCN
IFKNIDRNHYRTLRQAIIDMVLATEMTKHFEHVNKFVNSINKPMAAEIEGSDCECNPTGK
NFPENQILIKRMMIKCADVANPCRPLDLCIEWAGRISEEYFAQTDEEKRQGLPVVMPVFD
RNTCSIPKSQISFIDYFITDMFDAWDAFAHLPALMQHLADNYKHWKTLDDLKCKSLRLPS
DS
Download sequence
Identical sequences M3Y1M3
ENSMPUP00000005224 ENSMPUP00000005224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]