SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005249 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005249
Domain Number 1 Region: 66-158
Classification Level Classification E-value
Superfamily FKBP-like 3.01e-28
Family FKBP immunophilin/proline isomerase 0.00000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005249   Gene: ENSMPUG00000005287   Transcript: ENSMPUT00000005337
Sequence length 159
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897138.1:1854983:1865703:1 gene:ENSMPUG00000005287 transcript:ENSMPUT00000005337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSGHARGASKGFVRQTKTLRVLPQVPKMPPKGKSGSGKGGKGGAASGSDSSDKKAQGPK
GGGSAIKVRHILCEKHGKIMEAMEKLKSGMRFNEVATQYSEDKARQGGDLGWMTRGSMVG
PFQEAAFALPISGLDKPVFTDPPVKTKFGYHIIMVEGRK
Download sequence
Identical sequences M3Y1P8
ENSMPUP00000005249 XP_004777311.1.14098 ENSMPUP00000005249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]