SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005272 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005272
Domain Number 1 Region: 356-598
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.75e-79
Family Eukaryotic proteases 0.00000000365
Further Details:      
 
Domain Number 2 Region: 107-197
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-33
Family Kringle modules 0.00000764
Further Details:      
 
Domain Number 3 Region: 211-296
Classification Level Classification E-value
Superfamily Kringle-like 1.06e-26
Family Kringle modules 0.0000132
Further Details:      
 
Domain Number 4 Region: 45-101
Classification Level Classification E-value
Superfamily GLA-domain 1.85e-18
Family GLA-domain 0.0000969
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005272   Gene: ENSMPUG00000005310   Transcript: ENSMPUT00000005360
Sequence length 602
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896991.1:1399713:1414284:-1 gene:ENSMPUG00000005310 transcript:ENSMPUT00000005360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHIRGLWAAGCLALAVLLSLVRSQHVFLAPQQALSLLRRVPRANSGFLEELRKGNLERE
CVEEQCSHEEAFEALESVTITEVFWSKYIACESVRKPREKLIECLDGSCAEGLGMNYRGN
VSVTRSGIECQLWRSRYPHKPDINSTTHPGADLQENFCRNPDGSTSGPWCYTTDPTVRME
ECSVPVCGQGGVTVPMTPRSRGSTVNLSPPSDACIPERGRYYQGRQAVTAHGSPCLAWAS
SQAKALSKDQDFNPAVPLVENFCRNPDGDEEGAWCYVSEEPGGFEYCDLDYCEEPVEEVD
EDALSVDPDAAIEGRTGEGEFQPFFNEKTFGAGEAEPGTFYFSADPQLLMFLTPPPRQVM
LFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERSIEK
ISMLEKIYIHPRYNWRENLDRDIALLKLKKPIIFSDYIHPVCLPDKETAIRLLRAGYKGR
VTGWGNLKEMWTSSVTEVQPSVLQVVNLPIVERPVCRASTRIRITDNMFCAGFKPNEGKR
GDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQS
GS
Download sequence
Identical sequences M3Y1S1
ENSMPUP00000005272 ENSMPUP00000005272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]