SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005291 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005291
Domain Number 1 Region: 21-278
Classification Level Classification E-value
Superfamily Carbonic anhydrase 5.1e-91
Family Carbonic anhydrase 0.000000000987
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005291   Gene: ENSMPUG00000005329   Transcript: ENSMPUT00000005379
Sequence length 336
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897134.1:1841908:1847417:-1 gene:ENSMPUG00000005329 transcript:ENSMPUT00000005379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFFTLLLEVIWILAAEGGQHWTYEGPHGQDHWPASYPECGSNAQSPINIQTDSVTFDPE
LRPLQPHGYDQPSTEPLDLHNNGHTVQLSLPSTMYLEGLPRKYVAAQLHLHWGKTGSLGG
SEHQINSEATAAELHIVHYDSDSYDSLSEAAPKPQGLAVLGILIEVGETKNPVYEHILSH
LHEIRHKDQKTLVPPFNVGELLPPRRDQFFRYNGSLTTPPCYQSVLWTVFNQRAQISVEQ
LKELQETLFSTEEEPSKLLVQNYRAPQPLNQRTVSASFIQVQSSYTTGEMLSLGVGILVG
CLCLLLAVYFIARKIRKKRLGNGKSVVFTSAPATEA
Download sequence
Identical sequences M3Y1U0
XP_004776867.1.14098 XP_004776868.1.14098 ENSMPUP00000005291 ENSMPUP00000005291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]