SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005389 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000005389
Domain Number - Region: 253-303
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0085
Family RILP dimerisation region 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005389   Gene: ENSMPUG00000005428   Transcript: ENSMPUT00000005478
Sequence length 514
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897027.1:3812905:3828575:-1 gene:ENSMPUG00000005428 transcript:ENSMPUT00000005478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQPAGLQVDYVFRGVEHAVRVVVSGQVLELEVEDRMTADQWRGQFDASFIEDLTHKTGN
FKQFNIFCNMLESALTQSSESVTLDLLTYTDLESLRNRKMGSRSGPLASRSAQLNSKRYL
ILIYSVEFDRIHYPLPLPYQGKPDPVVLQGIIRSLKEELGRLRGLDGPDARDTRDTEIWH
LREQVSRLASEKRELEAQLGQSREEALAGRAARQEAEALRGLVRGLELELRQERGLGHRG
VSRRSQDCRRLAKELEEVKASERSLRARLRTVNTELAVYKKGRRTPPVPQPRAREDRASS
SRERSTSRGRGATRSSSRESGRGGRGRGRPARPSPSPTGSRAPRFDPTAFVKAKEKKQRE
IKLRQQQQRNRLGSGGSGDGPSLSWSRQTRPPAAVSGRGDAAHRSRNRSSSVDSFRSRCS
SASSCSELEDFSESLPRGVRRHGKPPSPTTWGGPRKQQKSTPLERSHHQRRLTSSGGWVP
MKEYSSDHQAADMAEIDARLKALQEYMNRLDTRS
Download sequence
Identical sequences M3Y238
XP_012919530.1.14098 XP_012919531.1.14098 XP_012919532.1.14098 ENSMPUP00000005389 ENSMPUP00000005389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]