SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005478 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005478
Domain Number 1 Region: 46-169
Classification Level Classification E-value
Superfamily FKBP-like 1.61e-39
Family FKBP immunophilin/proline isomerase 0.0004
Further Details:      
 
Domain Number 2 Region: 174-285
Classification Level Classification E-value
Superfamily FKBP-like 1.96e-36
Family FKBP immunophilin/proline isomerase 0.0003
Further Details:      
 
Domain Number 3 Region: 280-385
Classification Level Classification E-value
Superfamily FKBP-like 1.26e-33
Family FKBP immunophilin/proline isomerase 0.00037
Further Details:      
 
Domain Number 4 Region: 1-59
Classification Level Classification E-value
Superfamily FKBP-like 1.26e-16
Family FKBP immunophilin/proline isomerase 0.0021
Further Details:      
 
Domain Number 5 Region: 391-466
Classification Level Classification E-value
Superfamily EF-hand 0.000000000206
Family Calbindin D9K 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005478   Gene: ENSMPUG00000005520   Transcript: ENSMPUT00000005570
Sequence length 477
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896987.1:6460536:6497606:1 gene:ENSMPUG00000005520 transcript:ENSMPUT00000005570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQALVGMCVNERRFVKIPPKLAYGSEGVSGVIPPDSVLHFDVLLMDIWNSEDQVQVHTY
FTPPSCPRTIQVSDFVRYHYNGTFLDGTLFDSSHNRMKTYDTYVGIGWLIPGMDKGLLGM
CVGEKRIITIPPFLAYGEEGDGKDIPGQASLVFDVALLDLHNPKDGISIENKVVPENCER
HSQSGDFLRYHYNGTLLDGTFFDSSYSRNRTFDTYIGQGYVIAGMDEGLLGVCIGEKRRI
VVPPHLGYGEEGRGNIPGSAVLVFDIHVIDFHNPSDSISITSHYKPPDCSVLSKKGDYLK
YHYNASLLDGTLLDSTWNLGKTYNIVLGSGQVVLGMDMGLREMCVGEKRTVIIPPHLGYG
EAGVDGEVPGSAVLVFDIELLELVAGLPEGYMFIWNGEVSPNLFEEIDKDGNGEVLLEEF
SEYIHAQVASGKGKLAPGFDAEMIVKNMFTNQDRNGDGKVMAEEFKLKDQEAKHDEL
Download sequence
Identical sequences M3Y2C7
XP_004762701.2.14098 ENSMPUP00000005478 ENSMPUP00000005478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]