SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005617 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005617
Domain Number 1 Region: 471-610,727-887
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 6.28e-115
Family Substrate-binding domain of HMG-CoA reductase 0.0000000000768
Further Details:      
 
Domain Number 2 Region: 613-729
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 2.09e-44
Family NAD-binding domain of HMG-CoA reductase 0.000000575
Further Details:      
 
Domain Number 3 Region: 71-245
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.0000549
Family Multidrug efflux transporter AcrB transmembrane domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005617   Gene: ENSMPUG00000005662   Transcript: ENSMPUT00000005714
Sequence length 914
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897022.1:4439050:4505680:-1 gene:ENSMPUG00000005662 transcript:ENSMPUT00000005714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASHHVGILHFRSPQEDEGSKNSVATMLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSM
NMFTGNNKICGWNYECPKFEEDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGI
AGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASALAKFALSSNSQDEVR
ENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPA
CVSLVLELSRESREGRPIWQLSHFARVLEEEENKPNPVTQRVKMIMSLGLVLVHAHSRWI
ADPSPQNSTAENSKVSLGLDENVSKRIEPSVSLWQFYLSKMISMDIEQVITLSLALLLAV
KYIFFEQAETESTLSLKNPITSPVVTPKKVPDDCCRREPILVRNSQKVHTAEEETRINRE
RKVEVIKPLVAETDTPNRATFVVGNSSLLDTSLELETQEPEIELPVEPRPNEECLQILGN
AEKGAKFLSDAEIIQLVNAKHIPAYKLETLMETHERGVSIRRQLLSRKLPEPSSLQYLPY
RDYNYSLVMGACCENVIGYMPIPVGVAGPLCLDGKEFQVPMATTEGCLVASTNRGCRAIG
LGGGASSRILADGMTRGPVVRLPRACDSAEVKAWLETPEGFTVIKEAFDSTSRFARLQKL
QMTMAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPA
AINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAA
NIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQ
QACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKI
NLQDLQGTSTKKAA
Download sequence
Identical sequences M3Y2R6
ENSMPUP00000005617 ENSMPUP00000005617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]