SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005702 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005702
Domain Number 1 Region: 375-638
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.1e-85
Family Eukaryotic proteases 0.00000000313
Further Details:      
 
Domain Number 2 Region: 181-287
Classification Level Classification E-value
Superfamily Kringle-like 1.59e-32
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 3 Region: 289-378
Classification Level Classification E-value
Superfamily Kringle-like 1.59e-30
Family Kringle modules 0.0000291
Further Details:      
 
Domain Number 4 Region: 112-161
Classification Level Classification E-value
Superfamily FnI-like domain 4.19e-18
Family Fibronectin type I module 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005702   Gene: ENSMPUG00000005749   Transcript: ENSMPUT00000005801
Sequence length 639
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897151.1:48819:62657:1 gene:ENSMPUG00000005749 transcript:ENSMPUT00000005801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHFMYLTTVKTIYTIENIFQAPVAFPAVGVDAGGTGHDRVVGSRTLPHSLISRSHYEVF
FSPLLLPEFKVHSEGTINTMKRELVCVLLLFGAALSLSSQEIHTRFRRGARSYRVSCRDE
KTQTLYLQNESWLRPGLRGNRVEYCRCVGGRPHCHSVPVRSCSEPRCFNGGVCRQALYFS
DFVCQCPEGFMGKRCEIDASATCYKDQGITYRGTWSTAESGAECVNWNSSVLASKPYTGR
RPNAVQLGLGNHNYCRNPDRDSRPWCYVFKAGKYSSEFCSTPACPKEKYEDCYFGKGLAY
RGTYSLTASGTSCLSWNSVALAGKVYTAWKSNSQALGLGNHNYCRNPDGDAKPWCHVLKD
RKVTWEYCDVPQCSTCGLRQYKQPQFRIKGGLYTDITSHPWQAAIFVKNRRSPGERFFCG
GILISSCWVLSAAHCFQERYNPHHLRVVLGRTYREVPGEEEQKFEVEKYIIHEEFDDDTY
NNDIVLLKLQSDSLHCTQESDAVRAVCLPEATLQLPDWTECELSGYGKHEASSPFYSERL
KEAHVRLYPSRRCTSQHLFNKTITNNMLCAGDTRSGGNQANLHDACQGDSGGPLVCMKDN
RMTLVGIISWGIGCGQKDVPGIYTKVTNYLDWIQNNMRP
Download sequence
Identical sequences M3Y301
ENSMPUP00000005702 ENSMPUP00000005702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]