SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005906 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005906
Domain Number 1 Region: 98-142
Classification Level Classification E-value
Superfamily LysM domain 0.0000000111
Family LysM domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005906   Gene: ENSMPUG00000005957   Transcript: ENSMPUT00000006010
Sequence length 871
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897061.1:3441278:3802504:-1 gene:ENSMPUG00000005957 transcript:ENSMPUT00000006010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSNLSWLKKKSQSVDITAPGFNPLAAAGKQTPQASKPPTPKTPVIEEEQNNATNTQKH
PSRRSELKRFYTIDTGQKKTLDKKDGRRMSFQKPKGTVEYTVESRDSLNSIALKFDTTPN
ELVQLNKLFSRAVVTGQVLYVPDPEYVSSVESSPSLSPISPLSPTSSEAEFDKATNPDVV
HPKEATPLPTFTGIRPARVVSSTSEEEEAFTEKFLKINCKYITSGKGTVSGVLLVTPNNI
MFDPHKTDPLVQENGCEEYGIMCPMEEVMSAAMYKEILDSKIKESLPIELDQVSGRDSCH
LKKMTRNHTDEIDSRTRDAGNDSASTAPRSTEESLSEDVFTESELSPIREELVSSDELRQ
DKSSGASSESVQTVHQSGIECLTAISESTNMPDHLKSDSGHSTNEVGTTSLKTDLNNLER
ATKEDRATGNFQEISGPKEQSTSIKGNTDQDFLLNENSHQEEGEKESMLCGEAADFKQKP
TVNRGKHGKEQNQDSETEVEELRKLWKTHTMQQTKQQRENIQQVSQKEIKHKIAIADIEG
SALLKEKRRHRLHKFLCLRVGKPMRKTFVSQASATMQQYAQRDKKHEYWFAVPQERTDHL
YAFFIQWSPEIYAEDTGEYTREPGFIVVKKIEESETNEDSTNEAAAREWEVVSVAEYHRR
IDALNTEELRTLCRRLQITTREDLNSKQIAPLKADLESESFRPNLSDPSELLLPDQIEKL
TKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQVFGALASEPF
KVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYH
GRSHSCKTFGNHTLSKKEDFFIQDIEIWAFE
Download sequence
Identical sequences M3Y3K5
XP_004771378.1.14098 XP_004771379.1.14098 ENSMPUP00000005906 ENSMPUP00000005906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]