SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006003 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006003
Domain Number 1 Region: 88-164
Classification Level Classification E-value
Superfamily Ribosomal protein L6 7.67e-25
Family Ribosomal protein L6 0.00069
Further Details:      
 
Domain Number 2 Region: 1-85
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.4e-24
Family Ribosomal protein L6 0.00000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006003   Gene: ENSMPUG00000006054   Transcript: ENSMPUT00000006108
Sequence length 172
Comment pep:novel scaffold:MusPutFur1.0:GL896999.1:3794482:3798906:-1 gene:ENSMPUG00000006054 transcript:ENSMPUT00000006108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKW
WGNRKELATVRTICSHVQNMIKGVTLENGSLVEIRNFLGEKYIRRVRMRPGVACSVSQAQ
KDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE
Download sequence
Identical sequences M3Y3V2
ENSMPUP00000006003 ENSMPUP00000006003 ENSPANP00000003971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]