SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006203 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006203
Domain Number 1 Region: 125-219
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 1.31e-35
Family VPS28 C-terminal domain-like 0.00033
Further Details:      
 
Domain Number 2 Region: 22-118
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 1.54e-33
Family VPS28 N-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006203   Gene: ENSMPUG00000006256   Transcript: ENSMPUT00000006311
Sequence length 221
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897203.1:410066:412748:1 gene:ENSMPUG00000006256 transcript:ENSMPUT00000006311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTVQALEKAYIKDC
VTPNEYTAACSRLLVQYKAAFRQVQGAEISSIDEFCRKFRLDCPLAMERIREDRPITIKD
DKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTV
SQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHA
Download sequence
Identical sequences M3Y4F2
XP_004779460.1.14098 ENSMPUP00000006203 ENSMPUP00000006203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]