SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006556 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006556
Domain Number 1 Region: 248-350
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.54e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006556   Gene: ENSMPUG00000006609   Transcript: ENSMPUT00000006668
Sequence length 1086
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897035.1:1598307:1656156:-1 gene:ENSMPUG00000006609 transcript:ENSMPUT00000006668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSQKFQLQSLQVESSNSEQQDRNRVSEELVMLVQEMKKYFPSGRHSKPSTVDALNYALR
CVHRVQANSGFSQTLSQSGAPQAAATTYSLEELGMATSGYPSKNTDTFVAVFSFLSGRLV
HISEQAASILNCKNDFLESSHFVELLAPQDVRVFCAHTAHARLPLWNSWAQTASQYDSTP
VKSFFCRIRGGQDTEQEKHYCPVRIIPYLLHVCSSAQLESEPCCLILVEKIHSGYEAPRI
PVDKRIFTTTHTPGCVFLEIDERAVPLLGYLPQDLMGTSVLAYLHPEDHSLMLTVHQKVL
KYAGHPPFEYLPIRFCTQNGDYVILDSSWSSFVNPWSRKVSFIIGRHKVRTSPLNEDVFA
TRKRKTNSHDKDITELQEQIHKLLLQPVHRGASSGFGSLGGSGSHAPCVRLAASRKSSGP
RAEAAPGTELPPQQVCASGNKTTTLGQQLYVESTAKPPGLKSKGDTCISIEVSDEQKASS
TFQTLKNNSMPLESYEDWRKDQHNPSHQQINCIDSVIRYLKSYNIPALKRKCISCTNTTS
SSSEKDRHNHKPNDAEDLHAIANLEMPTTGRPALAAGGTPRTLAPTALSLGSGLNQCSYR
STLIPAPPPETGAAFTFCSQWQIRKNNEHTKEGQKRRKRATAMTTRGRMSNEVHSYIRKW
TDRVDEVLYACCCNNSCKNLLKYASLSMVAGDSASKQAGSAGCKKGKPGRKKPSGPWNSR
DAQDTFCPRLGGDGRHRQPWSPSLASSLPSPAALMAPDLATYLVPALPSVGRDHAVSLTA
LNRLPKATLWNDLQTFPALPSSLDTVMTIFLPDPHGCPLLSPSFCPYDFLGTAGSSGTLA
SLSAVAPHLEPLSSVPGRRRAEGKWEMRCGEHPCVNSGSSSPLQLNLLQADMLGSCESSD
QTRRDICPEAKSNRISGSRGKSSGFATGELSTALLHEEPPSGTGSAASGSRDSSVDFAST
DCPETTSNGQQSEDAQEEETFPGLADEAMWRRRKQTPERVLMTYQVPERVTEAVLSEDLE
KLAGLQGRQPRFLCGQREELAKVHSWIQSQTVPQGIDIQGCVTCESQDSPGDTAEPCGQA
PAANSG
Download sequence
Identical sequences M3Y5F5
ENSMPUP00000006556 ENSMPUP00000006556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]